KEGG   Bacillus thuringiensis BMB171: BMB171_C4616Help
Entry
BMB171_C4616      CDS       T01239                                 

Definition
Prolyne dehydrogenase
Orthology
K00318  
proline dehydrogenase [EC:1.5.-.-]
Organism
btb  Bacillus thuringiensis BMB171
Pathway
Arginine and proline metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:btb00001]
 Metabolism
  Amino acid metabolism
   00330 Arginine and proline metabolism
    BMB171_C4616
Enzymes [BR:btb01000]
 1. Oxidoreductases
  1.5  Acting on the CH-NH group of donors
   1.5.-  Acting on the CH-NH group of donors
    1.5.-.-  
     BMB171_C4616
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(4823794..4824711)
Genome map
AA seq 305 aa AA seqDB search
MEQLMRNSFLFLSKNKALTKLAKKYGLRFGAGRFVAGETIELATAAIQQLNKQGLCVTID
YLGEFVDNEAEANEMANQSIEAIRAIGREGLDSQLSLKMTSMGLDISDEIVMNNMRRILE
AAKENGVFVTIDMEDYTRCGKTIDIFKQLKSEYDNIGTVIQAYLYRTEKDIEDLNAYKPN
LRLVKGAYKEPEEVAFPDKKDVDDNYKKIIKMHLLNGNYTAIASHDEAIIEYTKKLAEEH
NIPRDQFEFQMLYGIRNERQLELVKEGYKMRVYVPYGNDWYGYFMRRLAERPANVAFVLK
GMVKK
NT seq 918 nt NT seq  +upstreamnt  +downstreamnt
atggaacaattaatgcgaaattcgtttcttttcttatctaaaaataaagcgctaacaaaa
ctggctaaaaagtacggtttacgctttggtgcaggtcgcttcgtcgcaggggagacgatt
gaattagcgacagctgccattcaacaattaaataagcaaggtctttgtgtaacaatcgat
tatttaggtgaattcgttgataatgaagcggaagcaaatgaaatggctaaccaatcgatt
gaagcgatccgtgcaattggaagagaaggtcttgattcgcagctttctttaaagatgact
tctatgggattagatatctctgatgaaatcgtaatgaacaatatgcgccgtattttagaa
gctgcaaaagaaaatggtgtgttcgttacaattgatatggaagattatacacgctgcggt
aaaacaattgatatctttaaacaattaaaatctgagtacgataatattggtactgttatt
caagcttacctatatcgtacagaaaaagatattgaggatttaaatgcttataaacctaat
ttacgtcttgtaaaaggagcttataaagaacctgaagaagtggcgttcccggacaagaaa
gatgtagatgacaattataaaaagattattaaaatgcacttattaaatggaaattatact
gcaattgcttcacatgacgaagcaattattgaatatacaaaaaaacttgctgaagaacat
aatattccaagggatcaatttgaattccaaatgttatatggtattcgtaatgagcgtcaa
cttgagctagtaaaagaaggttacaaaatgcgtgtttacgtaccttatggaaacgattgg
tatggatatttcatgcgccgtctagcagagcgtccagcaaacgttgcgttcgtattaaaa
ggtatggttaaaaaataa

DBGET integrated database retrieval system