KEGG   Bacillus thuringiensis BMB171: BMB171_C4728Help
Entry
BMB171_C4728      CDS       T01239                                 

Gene name
tpiA
Definition
(GenBank) triosephosphate isomerase
  KO
K01803  triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
btb  Bacillus thuringiensis BMB171
Pathway
btb00010  Glycolysis / Gluconeogenesis
btb00051  Fructose and mannose metabolism
btb00562  Inositol phosphate metabolism
btb01100  Metabolic pathways
btb01110  Biosynthesis of secondary metabolites
btb01120  Microbial metabolism in diverse environments
btb01130  Biosynthesis of antibiotics
btb01200  Carbon metabolism
btb01230  Biosynthesis of amino acids
Module
btb_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
btb_M00002  Glycolysis, core module involving three-carbon compounds
btb_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:btb00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    BMB171_C4728 (tpiA)
   00051 Fructose and mannose metabolism
    BMB171_C4728 (tpiA)
   00562 Inositol phosphate metabolism
    BMB171_C4728 (tpiA)
Enzymes [BR:btb01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     BMB171_C4728 (tpiA)
Exosome [BR:btb04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   BMB171_C4728 (tpiA)
  Exosomal proteins of bladder cancer cells
   BMB171_C4728 (tpiA)
  Exosomal proteins of melanoma cells
   BMB171_C4728 (tpiA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TIM
Motif
Other DBs
NCBI-ProteinID: ADH09536
Position
complement(4941986..4942741)
Genome map
AA seq 251 aa AA seqDB search
MRKPIIAGNWKMNKTLSEAVSFVEEVKGQIPAASAVDAVVCSPALFLERLVAATEGTDLQ
VGAQNMHFEKNGAFTGEISPVALSDLKVGYVVLGHSERREMFAETDESVNKKTIAAFEHG
LTPIVCCGETLEERESGKTFDLVAGQVTKALAGLTEEQVKATVIAYEPIWAIGTGKSSSS
ADANEVCAHIRKVVAEAVSPEAAEAVRIQYGGSVKPENIKEYMAQSDIDGALVGGASLEP
ASFLGLLGAVK
NT seq 756 nt NT seq  +upstreamnt  +downstreamnt
atgcgtaaaccaattatcgcaggtaactggaaaatgaataaaactctatcagaagcagtt
agtttcgtagaggaagttaaaggtcaaatcccagcagcttcagctgttgatgcagtagtt
tgctctccagctctattcttagagcgccttgtagcagcaactgaaggaactgacttacaa
gtaggtgcacaaaacatgcacttcgaaaaaaatggtgcattcactggcgaaattagccca
gtagcacttagcgacttaaaagttggctatgtagtacttggccactctgagcgtcgtgaa
atgtttgctgaaacagatgagtcagtaaacaaaaagactatcgcagcatttgaacatggt
ttaacaccaatcgtatgttgtggtgagactttagaagagcgcgaaagcggaaaaacattt
gatctagtagcaggtcaagtgacaaaagcacttgcaggtttaacagaagagcaagttaaa
gcaactgttatcgcttatgagccaatctgggctatcggtacaggtaaatcttcttcttct
gcagatgcaaacgaagtatgtgcgcacatccgtaaagttgttgcagaagctgtttctcca
gaagctgcagaagctgttcgtatccaatacggcggtagcgtaaaaccagaaaacattaaa
gagtatatggcacaatctgacatcgacggcgctttagttggcggtgctagcttagagcct
gcttcgttcttaggtcttctgggggcggtaaaatga

DBGET integrated database retrieval system