KEGG   Bacillus thuringiensis BMB171: BMB171_C4930Help
Entry
BMB171_C4930      CDS       T01239                                 

Gene name
murA2
Definition
UDP-N-acetylglucosamine 1-carboxyvinyltransferase
Orthology
K00790  
UDP-N-acetylglucosamine 1-carboxyvinyltransferase [EC:2.5.1.7]
Organism
btb  Bacillus thuringiensis BMB171
Pathway
Amino sugar and nucleotide sugar metabolism
Peptidoglycan biosynthesis
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Amino sugar and nucleotide sugar metabolism [PATH:btb00520]
Metabolism; Glycan biosynthesis and metabolism; Peptidoglycan biosynthesis [PATH:btb00550]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(5153002..5154291)
Genome map
AA seq 429 aa AA seqDB search
MEKLLIEGGRALNGTIRVSGAKNSAVALIPATILADTPVTIGGVPNISDVKMLGDLLEEI
GGKVTYGQEEEMVVDPSNMVAMPLPNGKVKKLRASYYLMGAMLGRFKKAVIGLPGGCHLG
PRPIDQHIKGFEALGAHVTNEQGAIYLRADELRGARIYLDVVSVGATINIMLAAVRAKGR
TVIENAAKEPEIIDVATLLTSMGARIKGAGTDVIRIDGVDSLHGCHHTIIPDRIEAGTYM
ILGAASGGEVTVDNVIPQHLESVTAKLREAGVQVETNDDQITVNGNRKLKVVDIKTLVYP
GFPTDLQQPFTTLLTKAHGTGVVTDTIYGARFKHIDELRRMNAQIKVEGRSAIVTGPVLL
QGAKVKASDLRAGAALVIAGLMADGITEVTGLEHIDRGYENIVDKLKGLGANIWREQMTK
QEIEEMKNA
NT seq 1290 nt NT seq  +upstreamnt  +downstreamnt
atggaaaaattgctaattgaaggcggaagagctttaaatggaacaattcgagtaagtggt
gcaaagaacagtgccgttgcattaattccagcgacaattttagcagatactccagtaact
attggtggtgtccctaatatttcggacgtgaaaatgttaggagacttactagaggaaatt
ggagggaaagtaacttatggacaggaggaagagatggtagtcgatccttctaacatggtt
gcaatgcctttgccaaatggaaaagtgaaaaaattgcgcgcttcttattatttaatgggt
gcaatgcttggccgttttaaaaaagctgttattgggcttccgggtggatgtcatttagga
ccgaggccgattgatcagcatattaaagggtttgaagcgctaggtgcacatgttacgaat
gaacaaggtgccatctatttaagagcagatgagctacgcggggcacgtatttatttagat
gttgttagtgtaggagctacgattaatattatgctagcagctgtacgagcgaaaggtaga
actgttattgaaaatgcagcgaaagagcctgagatcattgatgtagctacattgttaaca
agcatgggagcacgtattaaaggtgctggtactgacgtaatccgaatagatggtgttgac
tctttacatggttgtcaccatactatcatcccagatcgtattgaagctggtacgtatatg
attctaggagctgcatcaggaggagaagtaacggttgataacgttattcctcagcattta
gaatcagttactgcaaagctaagagaagctggtgttcaagttgaaacgaacgatgatcaa
attacggtaaacggtaatagaaagttaaaagtagttgatatcaaaacgcttgtatatcca
ggttttccaacggatttacaacagccgtttacgacgcttttaacaaaggcacacgggacg
ggagttgtaacagatacaatttacggtgcccgtttcaaacacattgatgaattacgtcgt
atgaatgctcaaattaaagtagagggtcgttcggcaattgtaactggtccagtgttactg
caaggtgcaaaagtgaaggcgagtgatttacgagcaggagcggcacttgttattgcaggg
ttaatggcagatggaattacagaagtaacaggacttgagcatattgatcgaggttatgag
aatatagtggacaagcttaaagggcttggtgcaaacatttggcgagaacaaatgacaaag
caagaaattgaagaaatgaagaacgcataa

DBGET integrated database retrieval system