KEGG   Bacillus thuringiensis BMB171: BMB171_P0244Help
Entry
BMB171_P0244      CDS       T01239                                 

Definition
tyrosinase
Orthology
K00505  
tyrosinase [EC:1.14.18.1]
Organism
btb  Bacillus thuringiensis BMB171
Pathway
Tyrosine metabolism
Riboflavin metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Amino acid metabolism; Tyrosine metabolism [PATH:btb00350]
Metabolism; Metabolism of cofactors and vitamins; Riboflavin metabolism [PATH:btb00740]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
pBMB171:complement(265538..266281)
Genome map
AA seq 247 aa AA seqDB search
MGIRKNQACLTDEEKAAFVDAIQELKRNGEYQPYVDVHRKHFFHPIHQSAMFLPWHREFL
HKFEIELQKVNRNVTIPYWDWTVDNSITSSIWRGNFMGAFTGLNRQLGANPFLPTRTQVK
EAIDTTPYDTAPWRQVTSGFRSALEELHNGPHNWVGGVMAGAGSPEDPVFWLHHSNIDRL
WAIWQREHLNEPYLPTSGTTGADELGLDDPMHEFREGEKNTLTPKDVLDHTSLGYQYDNY
SLDPVDC
NT seq 744 nt NT seq  +upstreamnt  +downstreamnt
atgggaataagaaaaaatcaagcatgtttgacagatgaagagaaggcagcttttgtagat
gcaattcaggaactaaaaagaaatggagaatatcaaccctatgttgatgtacatcgtaaa
catttttttcatcctatacatcaaagtgcaatgtttctcccatggcatcgtgaatttctt
cataaattcgaaattgaattacaaaaagttaatcgaaatgtgacaattccatattgggat
tggacggttgataattcaataacatcttcaatatggcgaggaaactttatgggagcattt
acagggctgaatcgtcaattaggtgcaaatccttttttgccaactcgtactcaagttaag
gaagctatagatacaacgccctatgatacagctccctggaggcaggtaacaagtggtttt
agaagtgcattagaagagttgcataatggtcctcataattgggttggaggagttatggca
ggagcaggatcacccgaagatccagttttttggttgcatcatagcaatattgatcgtctt
tgggctatatggcaaagagaacatcttaatgaaccttatttaccaactagtggtacaaca
ggtgcagatgaattgggactagatgatccaatgcatgaatttagagaaggagaaaaaaat
acattaactccgaaagacgtactagatcatacatctcttggatatcaatatgataactat
tcgttagatccagtagactgttga

DBGET integrated database retrieval system