KEGG   Bacillus thuringiensis serovar chinensis CT-43: CT43_CH0014Help
Entry
CT43_CH0014       CDS       T01838                                 

Definition
deoxyguanosine kinase
Orthology
K15519  
deoxyadenosine/deoxycytidine kinase [EC:2.7.1.76 2.7.1.74]
Organism
btc  Bacillus thuringiensis serovar chinensis CT-43
Pathway
Purine metabolism
Pyrimidine metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:btc00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    CT43_CH0014
   00240 Pyrimidine metabolism
    CT43_CH0014
Enzymes [BR:btc01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.74  deoxycytidine kinase
     CT43_CH0014
    2.7.1.76  2'-deoxyadenosine kinase
     CT43_CH0014
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(22340..22927)
Genome map
AA seq 195 aa AA seqDB search
MTTALANALGYRTSFEKVDSNPYLDKFYADFTRWSFHLQVYFLAERFKEQKRIFEYGGGF
VQDRSIYEDTGIFAKMHHEKGTMTETDYETYKGLFDAMVMTPYFPHPDLLIYLEGSFDDI
VDRIQERGRPMEQQTPIEYWKEMHGRYENWINNFNSCPVLRLNINEYDILKDGDSIEPII
KKIGHFLKQTRKLVK
NT seq 588 nt NT seq  +upstreamnt  +downstreamnt
atgacaactgcattagctaatgctttaggttatcgcacatcatttgaaaaagtagattcc
aatccatacttggacaagttctatgcggacttcactcgctggagcttccacctacaagtg
tactttttagcagaacgatttaaggaacaaaaaagaatttttgaatacggtggcggtttt
gttcaagatcgttctatttacgaagacactggaattttcgcaaagatgcatcatgaaaaa
ggtacgatgacggaaactgattatgaaacatacaaagggttatttgacgctatggtcatg
actccttacttccctcatccagacttattaatttacttagaaggttctttcgatgatatt
gtcgatcgtattcaagaacgcggacgcccaatggaacagcaaacgccaattgagtactgg
aaagaaatgcatggacgttatgaaaactggattaacaactttaattcatgccctgtatta
cgcttaaatattaatgagtacgatattttaaaagatggggattcaatcgaaccaatcatt
aaaaaaattggccattttttaaaacaaacacgtaaacttgtaaaataa

DBGET integrated database retrieval system