KEGG   Bacillus thuringiensis serovar chinensis CT-43: CT43_CH0040Help
Entry
CT43_CH0040       CDS       T01838                                 

Gene name
ipk
Definition
(GenBank) 4-diphosphocytidyl-2-C-methyl-D-erythritol kinase
  KO
K00919  4-diphosphocytidyl-2-C-methyl-D-erythritol kinase [EC:2.7.1.148]
Organism
btc  Bacillus thuringiensis serovar chinensis CT-43
Pathway
btc00900  Terpenoid backbone biosynthesis
btc01100  Metabolic pathways
btc01110  Biosynthesis of secondary metabolites
btc01130  Biosynthesis of antibiotics
Module
btc_M00096  C5 isoprenoid biosynthesis, non-mevalonate pathway
Brite
KEGG Orthology (KO) [BR:btc00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    CT43_CH0040 (ipk)
Enzymes [BR:btc01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.148  4-(cytidine 5'-diphospho)-2-C-methyl-D-erythritol kinase
     CT43_CH0040 (ipk)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GHMP_kinases_N GHMP_kinases_C Peptidase_C42
Motif
Other DBs
NCBI-ProteinID: AEA13733
Position
47882..48751
Genome map
AA seq 289 aa AA seqDB search
MKLLVKAPAKINLSLDVLGKRQDGYHEVKMIMTTIDLADRLELTELAEDRIEILSHNRYV
PDDQRNLAYQAAKLLKEKFNVKKGVSITIEKTIPVAAGLAGGSSDAAATLRGLNKLWNLG
LTIDELAELGAEIGSDVSFCVYGGTAIATGRGEKIEHIKTPPSCWVILAKPHIGVSTADV
YGNLKLNRVTHPNVDKMVDVINSGDYKGICDTVGNVLEDVTFGMHPEVARIKSQMKRFGA
DAVLMSGSGPTVFGLVHHDSRMHRIYNGLKGFCEQVYAVRLLGERETLE
NT seq 870 nt NT seq  +upstreamnt  +downstreamnt
ttgaagctactagtgaaagcaccagcaaagattaatctgtcgttagatgtactgggaaaa
agacaagacggatatcatgaagtgaaaatgattatgacaaccattgatttagcagatcgt
ctagaactaacggaattagcagaagaccgtattgaaattttatcccataatcggtatgtc
ccagacgaccaacgaaatttagcttatcaggcagcgaaattattaaaagagaagtttaat
gtaaaaaaaggtgtatctattactattgaaaaaacgattccagtagcagctggattagca
ggtggaagtagtgatgcagcagcgacattacgtggtcttaataaattatggaatttaggg
cttacaattgatgagttagcagagcttggcgcagaaattggatcagatgtatctttctgt
gtatacggcggcacagcaattgccactggaagaggagagaaaattgagcatataaagact
ccgccttcttgttgggttattttagcgaaaccacatataggtgtatctactgctgatgtg
tatggaaatttaaagttaaatcgagttacacatccaaatgtagataaaatggttgatgtc
ataaattctggagattataaagggatttgtgatactgttggtaacgttttagaagatgta
acatttggaatgcatcctgaagttgcacgtattaaatcacagatgaagcgattcggagcg
gatgctgtattgatgagtggaagtggtccaactgtatttggacttgtacaccatgattct
cgaatgcatcgcatttataacggattaaaaggattttgtgaacaggtctatgcggtacgt
ttattaggagagcgagaaacgcttgaataa

DBGET integrated database retrieval system