KEGG   Bacillus thuringiensis serovar chinensis CT-43: CT43_CH0067Help
Entry
CT43_CH0067       CDS       T01838                                 

Gene name
folP
Definition
dihydropteroate synthase
Orthology
K00796  
dihydropteroate synthase [EC:2.5.1.15]
Organism
btc  Bacillus thuringiensis serovar chinensis CT-43
Pathway
Folate biosynthesis
Metabolic pathways
Module
Tetrahydrofolate biosynthesis, GTP => THF
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:btc00790]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
77295..78128
Genome map
AA seq 277 aa AA seqDB search
MKWDYDLRCGEYTLNLNEKTLIMGILNVTPDSFSDGGSYNEVDAAVRHAKEMQGEGAHII
DIGGESTRPGFAKVSVEEEIKRVVPMIQAVSKEVKLPISIDTYKAEVAKQAIEAGAHIIN
DIWGAKAEPKIAEVAAHYDVPIILMHNRDNMNYRNLMADMIADLYDSIKIAKNAGVRDEN
IILDPGIGFAKTPEQNLEAMRNLEQLNVLGYPVLLGTSRKSFIGHVLDLPVEERLEGTGA
TVCLGIEKGCEFVRVHDVKEMARMAKMMDAMIGKGVR
NT seq 834 nt NT seq  +upstreamnt  +downstreamnt
ttgaagtgggattatgatttacgctgcggcgaatatacattgaatttaaatgaaaagaca
ttaattatggggattttaaatgtaacaccagattcgttttctgatggtgggagttacaac
gaggtagatgctgcggtacgtcacgcaaaagaaatgcaaggtgaaggtgctcatattatt
gatattggtggcgaatctactcgcccaggttttgctaaagtatcagtagaagaagaaata
aagcgagtcgtcccgatgattcaagcagtttcaaaagaagtaaaattacctatatctatc
gatacatataaagctgaagttgcaaagcaagcaattgaggctggtgctcatattattaat
gatatttggggggcgaaggcggagccgaaaattgctgaagtcgcagcccattatgatgta
cccatcattttaatgcataaccgtgataatatgaattatcgtaatttaatggcggatatg
attgctgatttgtatgacagtattaaaattgctaaaaatgctggtgtgcgagatgagaat
attattttagatccaggtatcggttttgctaaaacaccggagcagaacttagaggcgatg
cgtaatttagaacagttaaatgtgctaggttatccggttctcttaggtacttcgagaaag
tcctttattgggcacgtattagatttgccagtagaggaacgccttgagggaacgggagct
actgtttgtcttggtattgaaaagggctgtgagtttgttcgtgtccatgatgtgaaagaa
atggcgcgtatggctaaaatgatggatgcgatgattggtaagggggtaaggtaa

DBGET integrated database retrieval system