KEGG   Bacillus thuringiensis serovar chinensis CT-43: CT43_CH0084Help
Entry
CT43_CH0084       CDS       T01838                                 

Gene name
gltX
Definition
glutamyl-tRNA synthetase
Orthology
K09698  
nondiscriminating glutamyl-tRNA synthetase [EC:6.1.1.24]
Organism
btc  Bacillus thuringiensis serovar chinensis CT-43
Pathway
Aminoacyl-tRNA biosynthesis
Metabolic pathways
Module
Aminoacyl-tRNA biosynthesis, prokaryotes
Brite
KEGG Orthology (KO) [BR:btc00001]
 Genetic Information Processing
  Translation
   00970 Aminoacyl-tRNA biosynthesis
    CT43_CH0084 (gltX)
Enzymes [BR:btc01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.24  glutamate---tRNAGln ligase
     CT43_CH0084 (gltX)
Amino acid related enzymes [BR:btc01007]
 Aminoacyl-tRNA synthetase
  Class I (A)
   CT43_CH0084 (gltX)
Transfer RNA biogenesis [BR:btc03016]
 Prokaryotic Type
  Aminoacyl-tRNA synthetases (AARSs)
   Other AARSs
    CT43_CH0084 (gltX)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
106245..107702
Genome map
AA seq 485 aa AA seqDB search
MEKQVRVRYAPSPTGHLHIGNARTALFNYLFARHLDGKFIIRIEDTDVKRNVAGGEESQL
KYLKWLGMDWDEGVDVGGEFGPYRQTERLDIYKKLYLDLLERGLAYKCYMTEEELEAERE
GQISRGETPRYAGNHRDLTEEQMKEFEAEGRIPSIRFRVPANRDYTFKDIVKDEVAFHSN
DFGDFVIVKKDGIPTYNFAVAVDDHLMEITHVLRGDDHISNTPKQMMIYEAFGWDIPQFG
HMTLIVNESRKKLSKRDESIIQFIEQYKELGYLPEAIFNFIALLGWSPVGEEEIFSKDEF
IKMFDAARLSKSPALFDSQKLKWMNNQYMKKQDLDTVVELSLPHLVKAGRVGETLSEQDQ
DWIRGVIALYHEQMSFGAEIVELSEMFFKDHVDYEEEGQEVLKGEQVPEVLRAFAGQVEA
LEAMEPAAIKAAIKAVQKETGHKGKNLFMPIRVATTGQTHGPELPNAIALLGKEKVLNRL
QKVIG
NT seq 1458 nt NT seq  +upstreamnt  +downstreamnt
atggaaaagcaagtgagagtgcgctatgcgccaagtccaacaggacacttacatatcgga
aatgcgcgtacggcattatttaattatttatttgctcgtcatttagatggcaagtttatt
attcgtattgaagatactgatgtaaaacgtaacgtggctggtggagaagaaagccaatta
aaatacttaaaatggctcggtatggactgggatgaaggtgttgatgttggcggtgaattt
ggaccatatcgtcaaacagagcgtttagatatttataaaaaattatatctagatttatta
gagcgtggtttagcttacaaatgttatatgacagaagaagagctagaagcagagcgtgaa
ggacaaatttctcgtggtgaaacacctcgttatgcaggtaaccaccgtgatttaactgaa
gaacaaatgaaagaatttgaagctgagggacgtattccgagtattcgtttccgtgtacca
gctaatcgtgattacacattcaaagacatcgtaaaagacgaagttgcattccattcaaat
gattttggtgattttgttatcgtgaaaaaagatggaatcccaacttataactttgcggta
gcagtagatgatcacttaatggagattacacatgtacttcgtggtgatgatcatatttca
aacacgccaaaacaaatgatgatttatgaagctttcggttgggatatcccacaattcggt
catatgactttaattgtaaatgaaagtcgtaaaaaattaagcaagcgtgatgaatctatt
attcaatttattgagcaatataaagagcttggatatcttccagaagcaatctttaacttt
attgcgctattaggttggtcaccagtaggtgaagaagaaatcttctctaaagatgagttt
atcaaaatgtttgatgcagctcgtttatcaaaatcacctgcattatttgattctcaaaaa
ctaaaatggatgaacaaccagtatatgaaaaagcaagatttagatacggttgtagagtta
agtttaccgcatttagtgaaagctggacgtgtgggagaaactttaagtgaacaagatcaa
gattggatccgtggtgtaattgctttataccatgaacaaatgagttttggagctgaaatt
gtagagctttctgaaatgttcttcaaagatcatgttgattatgaagaagaaggacaagaa
gtattaaaaggtgaacaagtaccagaagtacttcgtgcatttgctggtcaagtagaagca
ctagaagcgatggaaccagcagcaattaaggcggctattaaagcagttcaaaaggaaaca
ggtcataaaggtaaaaacttatttatgccaatccgtgttgcaactactggtcaaacacat
ggtccagagcttccgaatgctattgcacttcttggaaaagaaaaagttttaaatcgtctt
caaaaagtaattggttaa

DBGET integrated database retrieval system