KEGG   Bacillus thuringiensis serovar chinensis CT-43: CT43_CH0589Help
Entry
CT43_CH0589       CDS       T01838                                 

Gene name
rbsK
Definition
ribokinase
Orthology
K00852  
ribokinase [EC:2.7.1.15]
Organism
btc  Bacillus thuringiensis serovar chinensis CT-43
Pathway
Pentose phosphate pathway
Brite
KEGG Orthology (KO) [BR:btc00001]
 Metabolism
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    CT43_CH0589 (rbsK)
Enzymes [BR:btc01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.15  ribokinase
     CT43_CH0589 (rbsK)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
679158..680054
Genome map
AA seq 298 aa AA seqDB search
MPNIAVVGSISMDLVAVSKKRPKAGETVIGEAFHTIPGGKGANQAVAAARLGANVAMVGA
VGNDDYGTVVRKNLENERIFIDYVVPVTDGTTGIAHIVLAEEDNSIVVVQGANALVNKSV
VDRSKDLLIKADMVVLQLEIPLETVKYVLAICEEHNIPVMLNPAPAQVLSEDILEKATYI
TPNEHECRIVLDDFTSPIEDLLAKYPNKLLMTEGSNGVRFHNGTEIVHVPSIAVDVVDTT
GAGDTFNGALAVALSEGETLQKAIRFANIAGGLSVTKLGAQGGMPTRNRVREVQVIVG
NT seq 897 nt NT seq  +upstreamnt  +downstreamnt
atgccaaatattgcagtagtaggtagcatttcaatggacttagtggctgtttcaaaaaaa
cggccgaaagcaggagaaacagtaattggtgaagcgtttcatacaatccctggagggaaa
ggggcgaaccaagcggttgctgcagctagattaggagcaaatgtagcaatggttggagcg
gtaggaaatgatgattacggaacggtagttagaaaaaatttagagaacgaacgtattttt
atcgactatgtggtaccggttacagatggaacgacaggaattgctcatatcgttttagca
gaagaagataacagtattgttgtcgtacaaggagcaaatgctcttgtaaataagtcagtt
gtagatcgctcaaaagaccttcttataaaagcagatatggttgttctgcaactagaaatt
ccacttgaaacagtaaaatatgtattggctatttgtgaggagcataatattccagttatg
ttaaatccagcgccagcacaagtgttatcagaagatattttagaaaaggcaacttatatt
acgccaaatgaacatgagtgccgcattgtattagatgattttacatcaccaattgaagat
ttattggcgaagtatccaaataaattattgatgacagaaggttctaacggtgttcgtttc
cataatggaacggagattgtacatgttcctagcattgctgttgatgtagtggatacaact
ggagctggtgatacatttaatggtgcgttagcagttgcactttctgaaggagagacactt
caaaaagcaattcgtttcgcgaatattgccggtggtctttctgtaacgaaacttggggca
cagggcggtatgccaacgagaaatcgagtacgtgaagtgcaggtgattgttggatga

DBGET integrated database retrieval system