KEGG   Bacillus thuringiensis serovar chinensis CT-43: CT43_CH1023Help
Entry
CT43_CH1023       CDS       T01838                                 

Gene name
hemY1
Definition
protoporphyrinogen oxidase
Orthology
K00231  
oxygen-dependent protoporphyrinogen oxidase [EC:1.3.3.4]
Organism
btc  Bacillus thuringiensis serovar chinensis CT-43
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Metabolism of cofactors and vitamins; Porphyrin and chlorophyll metabolism [PATH:btc00860]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1103951..1105372
Genome map
AA seq 473 aa AA seqDB search
MRKKVVIVGGGITGLTAMYNLQKNIHEKNLPIDTLLIEASGKLGGKIQTVRKDGFTIERG
PDSFLARKESVARLVKELGLGDELVNNQAGQSFILVNNRLHKMPNGSMMGIPTQITPFLF
SGLFSPIGKLRAGFDLLMPRSKPVSDQSLGQFFRHRLGNEVVENLIEPLLSGIYAGDIDE
MSLMSTFPQMYQIEQKHRSISLGMRTLAPKEEKAEPKKGMFQTVKTGLESIVKSLEAKMH
EGTIIKGTRIEKIAKQGDGYTITLSNGKEIEADAIVVATSHKVLPSMFAQYKQFRFFRNI
PSTSVANVALAFPKSAIQRDINGTGFVVSRNSDYTITACTWTHKKWPHTTPEGKTLLRCY
VGRAGDEAVVEQTEEELVQLVLEDLRKTMDITEDPEFTIVSRWKEAMPQYTVGHNERMKK
LTTFMEKELPGIYLAGSSYAGAGLPDCINQGEEAAKRVLSHLEKVIDAELIAQ
NT seq 1422 nt NT seq  +upstreamnt  +downstreamnt
ttgaggaaaaaagttgtgatcgtcggcggaggcatcactggattaacagcaatgtataac
ttacaaaaaaatattcatgaaaaaaacttgccgattgatacattacttatagaagcatcg
ggtaaactaggcggaaaaattcaaaccgttcgaaaagatggatttacaattgagcgcgga
ccggattctttcttagcacgaaaagaaagtgtagctagattagtgaaagaattaggtctc
ggcgatgaacttgtaaataatcaagccggtcaatcatttatccttgtaaacaatcggtta
cataaaatgccgaatggatcaatgatgggaattccaacgcaaattacgccgtttctattt
tccgggctgttctccccgattggtaaactaagagctggctttgatctattaatgccgagg
tcaaagccagtatctgaccaatcactcggacaattttttaggcatcgtcttggaaatgaa
gtggttgaaaacttaatagaaccgttactatcgggtatttatgcaggggatattgatgaa
atgagcttaatgtcaacattcccgcaaatgtatcaaattgagcagaaacatcgcagtatt
tcactcggtatgcgtacgctcgctccgaaagaagagaaagctgaaccgaaaaagggaatg
ttccaaacagtgaaaacaggtttagaatctatcgtaaaatctctcgaagcaaagatgcat
gaaggtacgataataaagggaactcgcattgaaaaaattgcaaaacagggtgatggttat
acgattactcttagtaacggaaaagaaatagaagcggacgccatcgtagtggcaacttcg
cataaagtattgccgtccatgtttgctcagtacaagcagtttcgtttcttccgtaatatt
ccatccacatccgttgccaatgtcgcacttgctttcccaaaatctgcaatccagcgcgat
attaatggtacaggatttgtcgtatcacgaaatagcgattacacgattacagcatgtacg
tggacgcataaaaaatggccacatacaacgccagaaggaaaaacactccttcgctgttac
gttggacgtgctggtgatgaagctgttgtagaacaaactgaagaagaactcgttcagctc
gtactagaagatttacgaaagacgatggatattacagaggatccagagtttacaatcgta
agtcgctggaaagaagcgatgcctcaatatactgtaggccataacgagcgaatgaaaaag
ctcacaacatttatggagaaagagttgccaggtatatacttggcaggtagctcctatgct
ggtgctggacttccagattgtattaatcaaggtgaggaagctgcaaagcgtgtattatct
catttggagaaagtaatagatgctgaattaatcgcacaataa

DBGET integrated database retrieval system