KEGG   Bacillus thuringiensis serovar chinensis CT-43: CT43_CH1089Help
Entry
CT43_CH1089       CDS       T01838                                 

Gene name
asnO1
Definition
asparagine synthetase
Orthology
K01953  
asparagine synthase (glutamine-hydrolysing) [EC:6.3.5.4]
Organism
btc  Bacillus thuringiensis serovar chinensis CT-43
Pathway
Alanine, aspartate and glutamate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:btc00001]
 Metabolism
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    CT43_CH1089 (asnO1)
Enzymes [BR:btc01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.4  asparagine synthase (glutamine-hydrolysing)
     CT43_CH1089 (asnO1)
Peptidases [BR:btc01002]
 Cysteine Peptidases
  Family C44
   CT43_CH1089 (asnO1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1169596..1171443
Genome map
AA seq 615 aa AA seqDB search
MCGITGWVDYKRSLEGERDVVTKMAETLAKRGPDDNKVWIKGNVAFGHKRLIVVDPEGGK
QPMTCLKDETNYAICYNGELYNTEDIRKELLRRGYTFKGHSDTEVLLASYIEWKEECVDH
LNGIYAFAVWDEQKEQVFIARDRLGVKPLFYKYDSGRLLFGSELKAILAHPDVKAEVTLE
GLSEIFGLGPSRTPGHGIYAGIKELRPGHAMTFSKNGLCIWRYWNVESKKHEDSFEETVE
KTRFLLQDAITRQLVSDVPLCTFLSGGVDSSAITAIAAKEYERSGKGQLHTYSIDYEDND
KYFKANAFQPNSDAPFINLMTETFQTTHHRCVISNEKLAEYLTEAVLVRDLPGMADIDSS
LLWFCREIKQDFVVGLSGECADEIFGGYPWFYREDDLQSSAFPWMRSTEAREQLLKKEWR
NKLNLQQYVQRRYEESIQEVPILEGESPLEAKRRQLFYLNMVWFMTTLLDRKDRMSMGAS
LEVRVPFADHRLVEYAWNIPWEMKMYKNREKGLLRKALEDVLPHDILYRKKSPYPKTHNP
HYTKAVTVWLQNLLTDKGSILHELFDKEQLNGLIQSGGSAFQTPWFGQLMTGPQLLAHLA
QIHVWFKEYGVNIKE
NT seq 1848 nt NT seq  +upstreamnt  +downstreamnt
atgtgcgggattacaggatgggtggattataaacgctcattagaaggagaaagagatgtc
gttacgaagatggctgagacgttagccaaacgtgggccggatgataataaagtttggatt
aaaggcaatgtcgcatttgggcataaacgtttaatcgttgtggaccctgagggcgggaaa
caaccgatgacttgtttaaaagatgaaacgaattacgccatttgctataacggtgaactt
tataacacagaagacattcgaaaggaattattaagaagaggatatacgttcaaaggtcat
tctgatacagaagtattattagcttcttatattgaatggaaagaagaatgtgtcgatcat
ttaaacggtatatatgcgtttgctgtatgggatgaacagaaagaacaagtatttattgcg
cgagatcgactaggtgtaaaaccgctattttataaatatgatagtgggcgattactattt
ggttcagagttaaaagcgatactggctcatccagatgtgaaggcggaagtaacgttagaa
gggttatccgaaatattcggcctcggaccgtcaagaacgcctggccatggtatttatgct
ggtataaaagaattacgtccaggtcatgcgatgacattttcaaagaacggtttatgtata
tggagatattggaatgtagaaagtaaaaaacatgaagactcttttgaagaaacagtagag
aaaacgcgctttttattacaagatgccattacaagacagcttgtttctgatgtaccacta
tgtacttttttatcaggtggtgtagattcgagcgctattacagctatcgcagcgaaagaa
tacgagagatcaggaaaagggcaattacacacgtattctattgattacgaagataatgac
aaatactttaaagcgaatgcgttccagccaaattcagatgctccgtttattaatttaatg
actgagacatttcaaacaacccatcatcgctgcgtcatttcgaatgaaaaattagcagag
tatttaactgaagcagtactcgttcgtgatttgcctggtatggcagatatcgattcgtca
ttattatggttttgtcgtgaaattaaacaagattttgtcgtcggtttatctggggaatgt
gcagatgaaatatttggtggatatccgtggttttatagagaagatgatttacaatcgagt
gcctttccgtggatgcgctctacagaagcacgtgaacaactgctaaagaaagaatggaga
aataaattaaatttacaacaatatgtacaaaggcgctatgaagagtcgattcaagaagtt
cctattttagagggagaaagtccgctagaagcaaaaagacgccaattattttatttaaat
atggtatggtttatgacaacattattagacagaaaagaccgcatgagtatgggggcaagt
ttagaagtacgtgttccatttgcagatcatcgccttgtcgaatatgcgtggaatattcct
tgggaaatgaaaatgtataaaaaccgcgaaaaaggtctattacgtaaagcgttagaagat
gtacttccacatgacatcttatatagaaagaagagtccttatccgaaaacgcacaatcca
cactatacaaaagcagtaacagtatggcttcaaaatctattaacggataaaggttcaatt
ttacacgaattgtttgataaagagcagttgaacggattaattcagtctggtggcagtgca
tttcaaacaccatggtttggtcaattgatgactgggccacagcttttagctcatttagca
caaattcacgtttggtttaaagaatatggggtaaatattaaggaataa

DBGET integrated database retrieval system