KEGG   Bacillus thuringiensis serovar chinensis CT-43: CT43_CH1173Help
Entry
CT43_CH1173       CDS       T01838                                 

Gene name
trpC
Definition
Indole-3-glycerol phosphate synthase
Orthology
K01609  
indole-3-glycerol phosphate synthase [EC:4.1.1.48]
Organism
btc  Bacillus thuringiensis serovar chinensis CT-43
Pathway
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:btc00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    CT43_CH1173 (trpC)
  Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    CT43_CH1173 (trpC)
Enzymes [BR:btc01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.48  indole-3-glycerol-phosphate synthase
     CT43_CH1173 (trpC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1248665..1249426
Genome map
AA seq 253 aa AA seqDB search
MGTILDKIVEQKKKEVAELYEIYTPVKTKRKTHSLVEALQQFTVIAEVKRASPSKGDINL
HVDVRKQVGTYEKCGAGAVSVLTDGQFFKGSFHDLQTAREESNIPLLCKDFIIDKIQIDR
AYEAGADIILLIVAALTKEKLKELYSYVLEKGLEAIVEVHDEQELETAIVLNPHVIGINN
RNLKTFEVDLSQTEKLGKRLNEEKLLWISESGIHSKEDIIRVKRAGAKGVLVGEALMTSS
SISSFFEDCKVNI
NT seq 762 nt NT seq  +upstreamnt  +downstreamnt
gtggggacgattttagataaaattgtagaacagaagaaaaaggaagttgcggagttatat
gaaatatatacaccagtaaaaacaaaaagaaagacacattcacttgtagaagcgttacag
cagtttactgtcattgcagaagtaaagcgagcatcaccatcaaaaggagatatcaattta
cacgttgacgtacgaaaacaagtgggaacatatgagaaatgtggtgcaggagcagtatct
gttttaacagatggtcaattttttaaaggatcgtttcacgatttacaaacagcaagagaa
gaaagtaacattccgcttttatgtaaagatttcataatcgataagattcaaatcgataga
gcgtatgaagcgggagcagatattattttactaatcgtagcagcgttaacgaaagagaag
ttaaaagagctgtatagctacgtgttagaaaaaggattagaagcgattgttgaagttcat
gatgaacaggaattagaaactgcgattgtattaaatccgcacgttattggcattaataat
cgtaatttaaaaacgttcgaagtagatttaagccaaactgaaaagcttggaaaaagattg
aatgaggagaaactactttggattagtgaaagtggcattcattcaaaagaagatattatt
cgtgttaaaagagctggagccaaaggtgtattagttggagaggcgcttatgacatcatct
tctattagtagtttttttgaagattgtaaggtgaatatatga

DBGET integrated database retrieval system