KEGG   Bacillus thuringiensis serovar chinensis CT-43: CT43_CH1335Help
Entry
CT43_CH1335       CDS       T01838                                 

Gene name
hisD
Definition
histidinol dehydrogenase
Orthology
K00013  
histidinol dehydrogenase [EC:1.1.1.23]
Organism
btc  Bacillus thuringiensis serovar chinensis CT-43
Pathway
Histidine metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Histidine biosynthesis, PRPP => histidine
Brite
KEGG Orthology (KO) [BR:btc00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    CT43_CH1335 (hisD)
  Amino acid metabolism
   00340 Histidine metabolism
    CT43_CH1335 (hisD)
Enzymes [BR:btc01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.23  histidinol dehydrogenase
     CT43_CH1335 (hisD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1395319..1396608
Genome map
AA seq 429 aa AA seqDB search
MKIIYEDFKEALSKVKVLRENANIIEETVQRSVREIIRNVREGKGEALSFYTKKFDGVEM
KDFRVSEEEIQQASMFVTNSFLEALKEAKKNIVSYHEKQKKHSIFDCESKGVIRGQLIRP
LENVGVYVPGGTASYPSSVLMNVLPAKLAGVKKIVMVTPPRKGGIDPHILAAANLAGVDE
IYTIGGAQAIAALAYGTESIPKVDKIVGPGNLYVALAKREVYGIVNIDMIAGPSEIVVVA
DETGNAKYIAADLLSQAEHDERATAICITTNMELAKEVEKEIERQLEMLPRSEIARESIN
RNGAIFIVPSLEEALKLSNEIAPEHLELHIKEPMNALDYVKHAGSIFLGSYAPEPLGDYL
AGPNHVLPTSGTARFFSPLSVDDFVKKSSFISYTEEALKNVQHHIVELANKEGLHAHARA
IQIRFEEEK
NT seq 1290 nt NT seq  +upstreamnt  +downstreamnt
atgaaaatcatttatgaagactttaaggaggcattatctaaagtaaaagtgctaagagaa
aacgctaatataatagaagaaactgttcaaagaagtgtaagagaaatcattagaaatgta
agggaagggaaaggtgaagctttatctttctatacaaaaaagtttgatggtgtagagatg
aaagattttcgtgtaagtgaagaagaaatacagcaagcgagtatgtttgtaacgaattca
tttttagaagctttaaaagaggcgaagaaaaacattgtttcgtatcacgaaaagcaaaag
aagcactcaatattcgattgtgaaagtaaaggcgtaattagagggcaactcattcggccg
ttagaaaatgtaggtgtatatgtaccgggtgggacagcctcatatccttcttcagtatta
atgaatgtattgccggcgaaactcgcaggtgtgaaaaagattgtaatggtaacaccgccg
aggaaaggaggaattgatccgcatatattagctgctgcaaatcttgcgggagtagatgaa
atttatacgataggtggcgcgcaagcaattgctgctttagcatacgggacggaatcgatt
ccgaaagtggataaaatagttggaccgggaaatttgtatgtcgctctagcgaagcgagaa
gtatacggaatagtaaatatcgatatgattgctggtccatcagaaattgtagttgtcgcg
gatgaaacaggtaatgcaaaatatatcgcagcggatttattatcgcaagcagagcatgat
gagagagcaacggcgatttgtattacaacgaatatggaactagctaaagaagtagaaaaa
gagatagaaagacagttagaaatgttaccaagaagtgaaattgcacgtgaatcaataaat
agaaatggagccatctttatcgttccttctttagaggaggcactaaagttatcaaatgaa
attgctccagaacatttagagttacatataaaagaaccgatgaatgctctagattatgtg
aaacatgcaggttctattttccttgggtcatatgcacctgaaccgctcggggattattta
gcgggaccgaatcatgtattaccaacgagcggaacggcaagatttttttctccgttatca
gtcgatgatttcgtgaaaaaatcaagttttatttcttatacggaggaagcattaaaaaat
gtacagcatcacattgtagagcttgcaaataaagaagggttacatgcacatgcgagagca
atccaaataaggtttgaggaggaaaaataa

  All links  
No link information was found.   
DBGET integrated database retrieval system