KEGG   Bacillus thuringiensis serovar chinensis CT-43: CT43_CH1922Help
Entry
CT43_CH1922       CDS       T01838                                 

Gene name
thrC
Definition
(GenBank) threonine synthase
  KO
K01733  threonine synthase [EC:4.2.3.1]
Organism
btc  Bacillus thuringiensis serovar chinensis CT-43
Pathway
btc00260  Glycine, serine and threonine metabolism
btc00750  Vitamin B6 metabolism
btc01100  Metabolic pathways
btc01110  Biosynthesis of secondary metabolites
btc01120  Microbial metabolism in diverse environments
btc01230  Biosynthesis of amino acids
Module
btc_M00018  Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:btc00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    CT43_CH1922 (thrC)
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    CT43_CH1922 (thrC)
Enzymes [BR:btc01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     CT43_CH1922 (thrC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PALP PK_C
Motif
Other DBs
NCBI-ProteinID: AEA15606
Position
1947114..1948172
Genome map
AA seq 352 aa AA seqDB search
MYKGLLKQYASYLPVNENTPDVSLMEGNTPLIPLLNISKQLGIQLYGKYEGANPTGSFKD
RGMVMAVAKAKEEGSEAIICASTGNTSASAAAYAARLGMKCIIVIPEGKIAHGKLAQAVA
YGAEIISIEGNFDDALKAVRNIAAEEPITLVNSVNPYRIEGQKTAAFEICDQLQNAPDVL
AIPVGNAGNITAYWKGFCEYEKEKGYKKPRIHGFEAEGAAAIVKGHVIEEPETIATAIRI
GNPASWSYAVEAAEQSCGEIDMVSDEEILHAYRLLAKTEGVFAEPGSNASLAGVIKHVKS
GKIKKGETVVAVLTGNGLKDPDIAISSNQLDIASLSNDIEQIKDHIKGVIMS
NT seq 1059 nt NT seq  +upstreamnt  +downstreamnt
atgtataaaggactattgaaacaatatgcttcttatttaccggtgaatgaaaacacacct
gatgtcagtttaatggaaggaaacacacctcttattccgttattaaatatatcaaagcaa
ttagggattcagctatatggtaagtacgaaggagcgaatccgacaggttcttttaaagat
cgtggtatggtgatggcagttgctaaggcgaaagaagaaggttcagaagcaatcatttgt
gcatcaacaggtaatacatcagcatcagctgcagcatatgcggcacgtcttgggatgaaa
tgtataatcgtaatccctgaaggaaagattgcgcatggaaaattagcgcaagcggtcgct
tatggagctgaaattatttcaatagaagggaatttcgatgatgcacttaaggctgtaaga
aatattgctgcagaagagccgattacattagtaaattcagtgaatccttatcgaattgaa
ggacaaaaaacagcagcatttgaaatttgtgatcaattgcaaaatgcaccagatgttcta
gctatccctgttgggaacgcagggaatattacagcatattggaaaggcttctgtgaatat
gagaaagaaaaaggttataagaagccaagaattcatggctttgaagcagaaggagcagcg
gcaattgtaaaagggcatgtaattgaagagcctgaaacaattgcaacagcaattcgcatt
ggtaacccagcaagttggtcgtatgcagtagaggctgccgagcagtcttgtggtgaaata
gatatggtatcagatgaagaaattttacatgcgtataggttattggcaaaaactgaagga
gttttcgctgaaccgggatcaaatgcttcattagctggcgtaattaaacatgttaaatct
ggaaaaatcaaaaagggagaaacagttgttgcagtattaactggaaatggtttgaaggat
cctgatatcgctatttcttcaaatcaactagacatcgcaagtttgtcaaatgatatagaa
cagattaaagatcatattaaaggggtgattatgtcgtga

DBGET integrated database retrieval system