KEGG   Bacillus thuringiensis serovar chinensis CT-43: CT43_CH2157Help
Entry
CT43_CH2157       CDS       T01838                                 

Gene name
dfrA
Definition
dihydrofolate reductase
Orthology
K00287  
dihydrofolate reductase [EC:1.5.1.3]
Organism
btc  Bacillus thuringiensis serovar chinensis CT-43
Pathway
One carbon pool by folate
Folate biosynthesis
Metabolic pathways
Module
Tetrahydrofolate biosynthesis, GTP => THF
Brite
KEGG Orthology (KO) [BR:btc00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    CT43_CH2157 (dfrA)
   00670 One carbon pool by folate
    CT43_CH2157 (dfrA)
Enzymes [BR:btc01000]
 1. Oxidoreductases
  1.5  Acting on the CH-NH group of donors
   1.5.1  With NAD+ or NADP+ as acceptor
    1.5.1.3  dihydrofolate reductase
     CT43_CH2157 (dfrA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2173572..2174060
Genome map
AA seq 162 aa AA seqDB search
MIVSFMVAMDENRVIGKDNNLPWRLPSELQYVKKTTMGHPLIMGRKNYEAIGRPLPGRRN
IIVTRNEGYHVEGCEVVHSVEEVFELCKNEEEIFIFGGAQIYDLFLPYVDKLYITKIHYA
FEGDTFFPEMDMTNWKEIFVEKGLTDEKNPYTYYYHVYEKQQ
NT seq 489 nt NT seq  +upstreamnt  +downstreamnt
atgattgtttcatttatggtcgcaatggacgaaaatagagtaattggtaaagataataat
ttaccttggcgtttaccgagtgaattacaatacgtgaagaaaacaacgatgggtcacccg
cttattatgggaagaaagaactatgaagcgattggtagaccgctgcctggaagacgtaat
attattgtaacacgtaatgaaggatatcacgttgaaggatgtgaagttgttcattctgta
gaagaagtattcgaactatgtaaaaatgaagaagagatttttatttttggcggagcgcaa
atttacgatctctttttaccatacgtagacaagttgtatataacaaaaattcattatgca
tttgaaggagatacattcttcccagaaatggatatgacaaattggaaagagatttttgta
gaaaaaggtttaacagatgaaaaaaacccgtatacgtattattaccacgtatatgagaaa
caacaataa

DBGET integrated database retrieval system