KEGG   Bacillus thuringiensis serovar chinensis CT-43: CT43_CH2421Help
Entry
CT43_CH2421       CDS       T01838                                 

Gene name
glsA2
Definition
glutaminase
Orthology
K01425  
glutaminase [EC:3.5.1.2]
Organism
btc  Bacillus thuringiensis serovar chinensis CT-43
Pathway
Alanine, aspartate and glutamate metabolism
Arginine and proline metabolism
D-Glutamine and D-glutamate metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:btc00001]
 Metabolism
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    CT43_CH2421 (glsA2)
   00330 Arginine and proline metabolism
    CT43_CH2421 (glsA2)
  Metabolism of other amino acids
   00471 D-Glutamine and D-glutamate metabolism
    CT43_CH2421 (glsA2)
Enzymes [BR:btc01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.2  glutaminase
     CT43_CH2421 (glsA2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2459144..2460124
Genome map
AA seq 326 aa AA seqDB search
MIKDSSVQVEGQEKVCLDQWVAHYRTYAAKGRSASYIPALGEIDVSQLGICIVKPDGTMI
KSGDWEIPFTLQSISKVIGFIAACLSRGISYVLERVDVEPTGDAFNSIIRLEIHKPGKPF
NPMINAGAITIASLLPGTSVQEKLESLYVLIEKMIEKRPAINEIVFQSEWETAHRNRALA
YYLKENGFLESDVEETLEVYLKQCSIEINTEDIALIGLILAHDGYHPIRKEQVLPKEVAR
LTKALMLTCGMYNASGKFAAFIGLPAKSGVSGGIMTLVPSKSRKDLSFQDGCGIGIYGPA
IDEYGNSLPGIMLLEHIAKEWDLSIF
NT seq 981 nt NT seq  +upstreamnt  +downstreamnt
atgataaaggattctagcgttcaagttgagggtcaagaaaaagtttgcttagatcaatgg
gtagctcattatcgaacgtatgcagctaagggacgaagcgccagttatattcctgctctg
ggggaaatagatgtatcgcagttaggtatttgtatagtaaagccagatggaacaatgata
aaatcaggagattgggagatacctttcacattacaaagtatatcaaaagtaatcggtttt
atagccgcttgtttaagtcgcggtatttcttatgtattagaacgagttgacgtagagcca
actggagatgcctttaattcaattattcgtttagagatacataaaccaggaaaacctttt
aatcctatgattaatgctggagcaattacgatagcttcacttttgccagggacatcggtg
caagaaaaattagaatctctatacgtattaattgaaaaaatgatagagaagcgtcccgct
attaatgaaatagtatttcaatcagaatgggaaacggctcatcgtaatagagcattagca
tactatttaaaggagaatggttttctagaatcagatgtggaggagacactagaggtttac
ctaaaacaatgttcgattgaaataaatacagaagatattgccttaatagggcttatacta
gcacatgatggatatcatcctattcgcaaagaacaagtgctccctaaagaagtagctagg
ttaacaaaagctttaatgcttacttgtggaatgtacaatgcttccggaaaatttgctgct
ttcattggattaccagctaagagtggggtatccggcggaattatgacacttgttccctca
aaatctaggaaggatttatcgtttcaagatggatgtggtattggtatttacggaccagcc
attgatgagtatgggaatagtttaccaggaattatgttgttagaacatattgcaaaagaa
tgggatttaagtatattttaa

DBGET integrated database retrieval system