KEGG   Bacillus thuringiensis serovar chinensis CT-43: CT43_CH2473Help
Entry
CT43_CH2473       CDS       T01838                                 

Definition
acetyl-CoA synthetase
Orthology
K01895  
acetyl-CoA synthetase [EC:6.2.1.1]
Organism
btc  Bacillus thuringiensis serovar chinensis CT-43
Pathway
Glycolysis / Gluconeogenesis
Pyruvate metabolism
Propanoate metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Class
Metabolism; Overview; Carbon metabolism [PATH:btc01200]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:btc00010]
Metabolism; Carbohydrate metabolism; Pyruvate metabolism [PATH:btc00620]
Metabolism; Carbohydrate metabolism; Propanoate metabolism [PATH:btc00640]
Metabolism; Energy metabolism; Methane metabolism [PATH:btc00680]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2519822..2521762
Genome map
AA seq 646 aa AA seqDB search
MKQAVWFPTEEYKEKTRLYGWMKSLGYEDYETFYNKSIEETAWFWGEAEKAVGYQWMKPY
TEVLDLENGTPFAQWYNGGTCNVVESALSRWLADEETRIQPALQYEGENGTSKSFTYEEL
DNWVSRVANGLKHAGIEKGDRVTIYMPMIPETVVAMLAVMKIGAIISPIFSGFASDAVMT
RVQAAGSKMIITADGFSRRGKIVSLKDEVDKACEHCPTVEKVVIVRHAGNDFTPHNYDFS
WSTLEKEKPFIHAEEMQSDDPLMLIYTSGTTGKPKGTVHTHAGFPLKAAFDAGFGMNIKQ
GDRVLWVTDMGWMMGPFLLFGSLINGATMVMYEGVPDFPEADRLWETVDKYEITHLGISP
TLIRALMAKGDEYVNKHSLKSLEVFASTGEPWNPDPWMWLFETVGKGNVPICNYSGGTEI
SGGIFGNVLIKPIAPISFNASLPGMAAVVLDDQGKPIQDEVGELCLEKPWVGMTKSFWED
DERYVNTYWSRFENKWVHGDWVIYDGEQYIITGRSDDTLNIAGKRIGPAEYESILVKHND
VIEAAAIGVPDEVKGEVCHCFVVLRDHVTFTGELKKELMSLVNSHIGKALCPKDIHVVED
LPKTRNSKVMRRVIKAAYLGKELGDLSSLVNPEVVPFIQGLQSSKL
NT seq 1941 nt NT seq  +upstreamnt  +downstreamnt
ttgaaacaagcagtttggtttccaacagaagagtacaaggaaaaaacacgtttatatggt
tggatgaaatcattgggatatgaagattatgaaactttttataataaatctattgaggaa
acagcttggttttggggagaggcagaaaaagcagttggctatcaatggatgaaaccttat
acagaagtattagatttagaaaatggtacaccgtttgcacagtggtataatggcggaaca
tgtaacgttgtagaatcagctttatcccgctggcttgcggatgaagagacgagaatacag
ccagcacttcagtacgaaggggaaaatggaacttcaaaatcatttacatatgaagagctt
gacaactgggtaagccgtgttgcaaatggtttgaaacacgcgggtattgagaaaggtgac
cgtgtaacaatttatatgccgatgattccagaaacagttgttgcgatgctagctgtaatg
aaaatcggagcaattatttcaccaatattctcaggctttgcgtctgatgcagttatgaca
cgtgtgcaagcggcaggttcaaaaatgattattaccgcagatggattttcacgccgcggt
aaaattgtttctttaaaagatgaagtagataaagcttgtgaacattgcccaactgttgaa
aaagttgttatcgttcgtcatgcaggaaatgattttacaccacataactatgacttttcg
tggagtacgctagaaaaagaaaaaccattcatacatgccgaggaaatgcaaagtgatgat
ccattaatgctcatttatacatcaggaacgactggtaagccgaaaggaacagtacacacg
catgcaggatttcctttgaaagcagcttttgatgcaggatttggaatgaatattaaacaa
ggtgatcgtgtattatgggtaactgatatgggctggatgatggggccgtttctattattc
ggttcactcattaatggagcaacgatggttatgtacgaaggtgttccagacttcccagaa
gcagaccggttatgggagacagttgataaatatgaaattactcatctaggtatttcgcca
acgttaatccgagcattaatggcaaaaggtgatgagtatgtcaataaacattctttaaag
agtttggaagtattcgcatcaacaggagaaccttggaatcctgatccatggatgtggctg
tttgaaacagttggaaaaggaaatgttccaatctgtaactactcaggtggaactgaaatc
tctggtgggattttcggtaatgttcttattaagccaatcgcaccgattagttttaacgca
tctttaccaggaatggcagctgtcgtgctggatgatcaaggtaaaccaattcaagatgaa
gtcggagaattatgcttagagaaaccttgggtaggtatgacgaaaagcttctgggaagat
gatgaacgttacgtgaacacatattggtcgcgttttgaaaataaatgggtccacggtgac
tgggtcatttacgatggtgaacaatatatcatcacagggcgttcagacgatacgttaaat
attgcaggtaaacgtattggacctgctgaatatgaatctattcttgtgaaacataatgat
gtaatcgaagctgctgcaattggtgtacctgacgaagtaaaaggtgaagtttgtcattgt
tttgtagtgttaagagatcatgtaacattcacaggagaattaaagaaagaattaatgagt
ttagtaaactctcatattggaaaagcgttgtgtcctaaagacatccacgttgtagaagat
ttaccgaaaacacgtaattctaaagtaatgcgccgtgttattaaagcagcttatttagga
aaagaattaggtgatttgtcgtcacttgtaaatcctgaagtagtaccgtttattcaaggg
ttacagtctagtaaattataa

DBGET integrated database retrieval system