KEGG   Bacillus thuringiensis serovar chinensis CT-43: CT43_CH2988Help
Entry
CT43_CH2988       CDS       T01838                                 

Definition
alkaline phosphatase
Orthology
K01077  
alkaline phosphatase [EC:3.1.3.1]
Organism
btc  Bacillus thuringiensis serovar chinensis CT-43
Pathway
Aminobenzoate degradation
Folate biosynthesis
Metabolic pathways
Microbial metabolism in diverse environments
Two-component system
Module
Tetrahydrofolate biosynthesis, GTP => THF
Brite
KEGG Orthology (KO) [BR:btc00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    CT43_CH2988
  Xenobiotics biodegradation and metabolism
   00627 Aminobenzoate degradation
    CT43_CH2988
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    CT43_CH2988
Enzymes [BR:btc01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.1  alkaline phosphatase
     CT43_CH2988
Exosome [BR:btc04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   CT43_CH2988
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3004066..3005739)
Genome map
AA seq 557 aa AA seqDB search
MLNYGVKMKKLLLVGAIIVSVLSTESMMNYHAAKAKVKKVEHQPKNIIMMVMDGTSSTAT
TLARWYKEAPLTLDQIVTGGVRTYSAESAITDSAPAATALATGNKSNSGYVGVLPSTVNS
PNLKPIKEEDKLRPVANVLEGAKRTGRATGIVATSEIQHATPAGFSAHHVNRKQFDVIAK
QQVYQNIDVVLGGGKAALLPMQSNGIRKDGENLVKVIQDRGYDFVETKDALLNSKSNKIW
GSFSNHALAFDIDRIATNPEQPTLSQMTEKAIQTLSKDKDGFFLFVEGSKPDWAAHANDP
IGMISDVLAFDEAVAKALQFAKKDGDTMLIALTDHGNSGISIGNRNTTKGYNTTPVSAYI
DSLKKAKMTLEGTINKLKSDLSNVEDVAKLYGLDNLTHDEKEKLKASKKKMDVGRILTTL
LANRANIGFTTGGHTGEDVFLHSYGPQKPEGLIQNTDIAKTMAKAMGFNLEEVTNKIFLE
SEQAFKKIGATVTADKTEGANPLLVVKHNKVEAQLFGNKNIIRINGKGYELGSIIVESNG
KCYVPEEAIQLFVKHSR
NT seq 1674 nt NT seq  +upstreamnt  +downstreamnt
atgttgaattatggtgtgaagatgaaaaagttactattagtgggagctataatagtaagc
gtattaagtacggaaagtatgatgaattatcatgcggccaaagctaaggtgaaaaaagta
gaacaccagcctaaaaatataattatgatggttatggacggaacaagttcaacggcgaca
acattggctcgctggtataaagaggcaccgcttacgttagatcaaattgtaacaggaggt
gttcgtacatattctgcagaatcagctattacagactcagcaccagcagcgacagcatta
gcaactggaaataaatcgaattcaggatatgtaggcgtactaccttctactgtaaattca
cctaacttaaagccaataaaagaagaggacaagttacggccggtcgcaaacgtattggaa
ggtgcaaaacgtactggccgtgcaactggaattgttgctacatctgaaattcagcatgct
actccggcgggattctcggctcaccatgttaatcgcaagcaatttgacgtaattgcgaag
caacaagtatatcaaaatatagatgtcgtattaggcgggggaaaagcggcgctgctacct
atgcaaagtaatggaatccgaaaagatggtgaaaatttagtgaaggtgattcaagacaga
ggatacgatttcgttgaaacgaaagatgcgttattgaactccaaatctaataaaatttgg
ggctctttctcaaatcatgctcttgcgtttgatatagatcgtatagcaacaaatccagaa
caaccaacactttctcaaatgacagaaaaagcaattcaaacattatcaaaagacaaagat
ggtttctttttattcgtagaaggtagtaagcctgattgggcagctcatgctaatgatcca
attgggatgattagtgatgtattggcatttgatgaagcggtagcaaaggcgttacaattt
gcgaagaaagatggggatacgatgctcatagctttaactgatcatggtaacagcggtatc
tctatagggaatagaaatacgacaaaaggatacaatactacaccggtttctgcatacatt
gattcattgaaaaaggcgaaaatgacacttgaaggaactataaataaactgaaatctgat
ttatcaaatgtagaagatgtagctaaactatacggtttggataatctaactcatgatgaa
aaagaaaaattaaaagcgtcaaaaaagaaaatggatgtaggacgaattcttactacatta
ttggctaatcgtgcaaatatcggctttacgacaggaggacatacaggtgaggatgtattt
ttacattcttatggacctcaaaaaccagaaggcttaatccaaaatacagacattgcgaag
acgatggcgaaagcgatgggctttaacttagaagaagtaacgaataaaatatttttggag
agtgaacaagcctttaagaaaatcggtgcaactgtaacagccgacaaaaccgaaggagca
aacccgttactcgtagtaaaacataataaagtagaagcacaattatttggtaacaaaaat
ataattcgtatcaatggtaaagggtatgaattaggaagtattattgtagagagtaatgga
aagtgctatgtaccagaagaagcaattcaactatttgtaaagcattctcgttaa

DBGET integrated database retrieval system