KEGG   Bacillus thuringiensis serovar chinensis CT-43: CT43_CH3164Help
Entry
CT43_CH3164       CDS       T01838                                 

Gene name
cypD
Definition
NADPH-cytochrome P450 reductase
Orthology
K14338  
cytochrome P450 / NADPH-cytochrome P450 reductase [EC:1.14.14.1 1.6.2.4]
Organism
btc  Bacillus thuringiensis serovar chinensis CT-43
Pathway
Fatty acid degradation
Tryptophan metabolism
Aminobenzoate degradation
Microbial metabolism in diverse environments
Class
Metabolism; Lipid metabolism; Fatty acid degradation [PATH:btc00071]
Metabolism; Amino acid metabolism; Tryptophan metabolism [PATH:btc00380]
Metabolism; Xenobiotics biodegradation and metabolism; Aminobenzoate degradation [PATH:btc00627]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3179998..3183195)
Genome map
AA seq 1065 aa AA seqDB search
MEKKVSAIPQPKTYGPLGNLPLIDKDKPTLSFIKIAEEYGPIFQIQTLSDTIIVVSGHEL
VAEVCDETRFDKSIEGALAKVRAFAGDGLFTSETHEPNWKKAHNILMPTFSQRAMKDYHA
MMVDIAVQLVQKWARLNPNENVDVPGDMTRLTLDTIGLCGFNYRFNSFYRETPHPFITSM
TRALDEAMHQLQRLDIEDKLMWRTKRQFQHDIQSMFSLVDNIIAERKSNGNQEENDLLSR
MLNVPDPETGEKLDDENIRFQIITFLIAGHETTSGLLSFAIYFLLKNPDKLKKAYEEVDR
VLTDPTPTYQQVMKLKYIRMILNESLRLWPTAPAFSLYAKEDTVIGGKYPIKKGEDRISV
LIPQLHRDKDAWGDNVEEFQPERFEELDKVPHHAYKPFGNGQRACIGMQFALHEATLVMG
MLLQHFELIDYQNYQLDVKQTLTLKPGDFKIRILPRKQTISHPTVLTPTEDKLKNDEIKQ
HVQKPPSIIGADNLSLLVLYGSDTGVAEGIARELADTASLEGVRTEVVALNDRIGSLPKE
GAVLIVTSSYNGKPPSNAGQFVQWLEELKPDELKGVQYAVFGCGDHNWASTYQRIPRYID
EQMAQKGATRFSKRGEADASGDFEEQLEQWKQNMWSDAMKAFGLELNKNIEKERSTLSLQ
FVSRLGGSPLARTYEAVYASILENRELQSPSSDRSTRHIEVSLPEGATYKEGDHLGVLPV
NSEKNINRILKRFGLNGKDQVILSASGRSINHIPLDSPVSLLDLLSYSVEVQEAATRAQI
REMVTFTACPPHKKELEALLEEGVYHEQILKKRISMLDLLEKYEACEIRFERFLELLPAL
KPRYYSISSSPLVAHNRLSITVGVVNAPAWSGEGTYEGVASNYLAQRHNKDEIICFIRTP
QSNFELPKDPETPIIMVGPGTGIAPFRGFLQARRVQKQKGINLGQAHLYFGCRHPEKDYL
YRTELENDERDGLISLHTAFSRLEGHPKTYVQHLIKQDRINLISLLDNGAHLYICGDGSR
MAPDVEDTLCQAYQEIHEVSEQEARNWLDRVQDEGRYGKDVWAGI
NT seq 3198 nt NT seq  +upstreamnt  +downstreamnt
atggaaaaaaaagtatctgccattcctcagccgaaaacatatggaccgctgggtaatctc
ccattaatcgataaagataaaccgaccctatcctttatcaagatagcggaagagtatggt
cccatttttcaaattcaaactttaagtgataccatcattgtcgtttctggacatgaattg
gtagcagaagtttgtgatgaaacacggttcgataaaagtatagagggtgctttagcaaaa
gttcgtgcctttgctggggacggattatttactagcgagactcacgagcctaactggaaa
aaagctcataatattttgatgcctacatttagccaacgggcaatgaaagattaccatgcc
atgatggtcgatattgctgtacaactcgttcaaaaatgggcacgacttaatccgaatgaa
aacgtagatgttccgggggatatgactcgtcttacgttagatacaattggtctatgtggt
tttaattaccgattcaatagcttttatcgtgagacccctcatccttttattactagcatg
acccgtgctctagatgaagcgatgcaccaattacagaggctggatatagaagataaactc
atgtggagaacgaaacgtcaatttcagcatgatattcaatctatgttttctttagtagat
aatattattgctgaacgtaaaagtaatgggaatcaggaagaaaatgatttactttcccgt
atgttaaatgtgccagatccggaaactggtgaaaaattagatgatgaaaatattcgtttc
caaattattacctttttaatagctggacatgagacaacaagtggattgttatcttttgca
atttattttttattaaagaatccggataagttgaaaaaagcctatgaagaagtagaccgt
gttttgacagatcctactccaacataccaacaagttatgaaactgaagtatatacggatg
attttaaatgaatcgctacgtctatggcctaccgctccagcattcagtctctatgcaaaa
gaagatacagtgattggcgggaaatacccaattaagaaaggagaagatcgtatttctgtt
cttattccacagctacatagggataaagatgcatggggagacaatgtggaagaattccaa
cctgaacgatttgaagagctggataaggttcctcatcatgcttataagccatttggaaat
ggccagagagcatgtatcggtatgcaatttgcacttcatgaagccactcttgtaatggga
atgcttcttcaacattttgaattaatcgattatcaaaactatcagctggacgtaaaacaa
acattaacgctaaagcccggtgattttaagattaggattctaccccgaaaacaaactatt
agtcatcctactgttcttacacctacagaggacaagctgaaaaacgatgaaattaagcag
cacgttcagaagccaccttctattattggggccgataatctttcacttcttgttctgtac
ggctcggatacaggtgtagcagaaggtattgcaagagaattagcagatacagctagttta
gaaggagttcgaacggaagtggtagctcttaacgatcggattggaagtttgccaaaagaa
ggagcggttcttattgtaacttcttcttataatggaaaaccgccaagtaatgcaggacag
tttgtgcaatggttggaggaactaaaaccggatgagctaaaaggtgttcaatacgcagtt
tttggttgtggagatcataattgggctagtacctatcaacggattccaagatacattgat
gagcagatggctcaaaaaggagcaacaagattttctaaacgcggagaagcagatgcaagt
ggtgatttcgaggaacagcttgagcaatggaaacaaaacatgtggtctgatgcgatgaag
gcatttggattggagctcaacaaaaatatagaaaaagagcgcagtactttgagtctgcaa
tttgttagtcgtcttggaggatctcctcttgcacgaacatatgaagcagtttatgcatct
atactagaaaatcgtgaactccaatcacccagcagtgatagaagtacacgacatatcgag
gtatctttgccagaaggcgctacatataaagaaggagaccaccttggagtgttgccagtt
aatagcgagaaaaatatcaaccgaattttaaaacgttttggattaaatgggaaggatcaa
gttatactgagtgcaagtggacgaagtataaatcacatacctttagacagtcctgttagt
ttattggaccttcttagttatagtgttgaagttcaagaagctgccactcgagcacaaata
cgagaaatggtaacattcacagcatgtcctcctcataaaaaagaattggaagcattatta
gaagaaggagtttaccatgaacaaatactaaagaaacggatttcaatgttggaccttctt
gaaaagtatgaggcttgtgaaatccgatttgaacgctttttagaacttcttcctgcgctc
aaaccgcgttactattctatttcaagctctccactcgttgcacacaatcgtctgagcatt
acggtcggtgttgttaatgcgcctgcatggagtggggaagggacatatgaaggagtcgct
tctaattacttagctcagcgtcataataaagatgagattatctgtttcattcgaacgcca
caatcaaactttgaattacctaaagatccagaaacaccaattattatggttgggccaggt
actggaattgcaccattccgtggattcttgcaagcgcgtcgtgttcaaaagcaaaaaggt
attaacttaggacaagcgcatctatattttggttgtcgtcatcctgaaaaagattatctc
tatcgtacagaattagaaaatgatgaaagagatggattaatctctttacacacagctttt
tctcgtctagagggacatccaaaaacatatgtacagcatttaataaaacaagatagaatc
aatttaatttcgttattagataatggagctcatctttatatatgtggtgatggaagtaga
atggctccggatgtagaagataccctttgtcaagcatatcaagaaattcatgaagtcagt
gaacaagaagcaagaaattggttggatcgtgtgcaagatgaagggcgatatggaaaagat
gtttgggctggtatatga

DBGET integrated database retrieval system