KEGG   Bacillus thuringiensis serovar chinensis CT-43: CT43_CH3164Help
Entry
CT43_CH3164       CDS       T01838                                 

Gene name
cypD
Definition
NADPH-cytochrome P450 reductase
Orthology
K14338  
cytochrome P450 / NADPH-cytochrome P450 reductase [EC:1.14.14.1 1.6.2.4]
Organism
btc  Bacillus thuringiensis serovar chinensis CT-43
Pathway
Fatty acid degradation
Tryptophan metabolism
Aminobenzoate degradation
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:btc00001]
 Metabolism
  Lipid metabolism
   00071 Fatty acid degradation
    CT43_CH3164 (cypD)
  Amino acid metabolism
   00380 Tryptophan metabolism
    CT43_CH3164 (cypD)
  Xenobiotics biodegradation and metabolism
   00627 Aminobenzoate degradation
    CT43_CH3164 (cypD)
Enzymes [BR:btc01000]
 1. Oxidoreductases
  1.6  Acting on NADH or NADPH
   1.6.2  With a heme protein as acceptor
    1.6.2.4  NADPH---hemoprotein reductase
     CT43_CH3164 (cypD)
  1.14  Acting on paired donors with incorporation of molecular oxygen
   1.14.14  With reduced flavin or flavoprotein as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.14.1  unspecific monooxygenase
     CT43_CH3164 (cypD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3179998..3183195)
Genome map
AA seq 1065 aa AA seqDB search
MEKKVSAIPQPKTYGPLGNLPLIDKDKPTLSFIKIAEEYGPIFQIQTLSDTIIVVSGHEL
VAEVCDETRFDKSIEGALAKVRAFAGDGLFTSETHEPNWKKAHNILMPTFSQRAMKDYHA
MMVDIAVQLVQKWARLNPNENVDVPGDMTRLTLDTIGLCGFNYRFNSFYRETPHPFITSM
TRALDEAMHQLQRLDIEDKLMWRTKRQFQHDIQSMFSLVDNIIAERKSNGNQEENDLLSR
MLNVPDPETGEKLDDENIRFQIITFLIAGHETTSGLLSFAIYFLLKNPDKLKKAYEEVDR
VLTDPTPTYQQVMKLKYIRMILNESLRLWPTAPAFSLYAKEDTVIGGKYPIKKGEDRISV
LIPQLHRDKDAWGDNVEEFQPERFEELDKVPHHAYKPFGNGQRACIGMQFALHEATLVMG
MLLQHFELIDYQNYQLDVKQTLTLKPGDFKIRILPRKQTISHPTVLTPTEDKLKNDEIKQ
HVQKPPSIIGADNLSLLVLYGSDTGVAEGIARELADTASLEGVRTEVVALNDRIGSLPKE
GAVLIVTSSYNGKPPSNAGQFVQWLEELKPDELKGVQYAVFGCGDHNWASTYQRIPRYID
EQMAQKGATRFSKRGEADASGDFEEQLEQWKQNMWSDAMKAFGLELNKNIEKERSTLSLQ
FVSRLGGSPLARTYEAVYASILENRELQSPSSDRSTRHIEVSLPEGATYKEGDHLGVLPV
NSEKNINRILKRFGLNGKDQVILSASGRSINHIPLDSPVSLLDLLSYSVEVQEAATRAQI
REMVTFTACPPHKKELEALLEEGVYHEQILKKRISMLDLLEKYEACEIRFERFLELLPAL
KPRYYSISSSPLVAHNRLSITVGVVNAPAWSGEGTYEGVASNYLAQRHNKDEIICFIRTP
QSNFELPKDPETPIIMVGPGTGIAPFRGFLQARRVQKQKGINLGQAHLYFGCRHPEKDYL
YRTELENDERDGLISLHTAFSRLEGHPKTYVQHLIKQDRINLISLLDNGAHLYICGDGSR
MAPDVEDTLCQAYQEIHEVSEQEARNWLDRVQDEGRYGKDVWAGI
NT seq 3198 nt NT seq  +upstreamnt  +downstreamnt
atggaaaaaaaagtatctgccattcctcagccgaaaacatatggaccgctgggtaatctc
ccattaatcgataaagataaaccgaccctatcctttatcaagatagcggaagagtatggt
cccatttttcaaattcaaactttaagtgataccatcattgtcgtttctggacatgaattg
gtagcagaagtttgtgatgaaacacggttcgataaaagtatagagggtgctttagcaaaa
gttcgtgcctttgctggggacggattatttactagcgagactcacgagcctaactggaaa
aaagctcataatattttgatgcctacatttagccaacgggcaatgaaagattaccatgcc
atgatggtcgatattgctgtacaactcgttcaaaaatgggcacgacttaatccgaatgaa
aacgtagatgttccgggggatatgactcgtcttacgttagatacaattggtctatgtggt
tttaattaccgattcaatagcttttatcgtgagacccctcatccttttattactagcatg
acccgtgctctagatgaagcgatgcaccaattacagaggctggatatagaagataaactc
atgtggagaacgaaacgtcaatttcagcatgatattcaatctatgttttctttagtagat
aatattattgctgaacgtaaaagtaatgggaatcaggaagaaaatgatttactttcccgt
atgttaaatgtgccagatccggaaactggtgaaaaattagatgatgaaaatattcgtttc
caaattattacctttttaatagctggacatgagacaacaagtggattgttatcttttgca
atttattttttattaaagaatccggataagttgaaaaaagcctatgaagaagtagaccgt
gttttgacagatcctactccaacataccaacaagttatgaaactgaagtatatacggatg
attttaaatgaatcgctacgtctatggcctaccgctccagcattcagtctctatgcaaaa
gaagatacagtgattggcgggaaatacccaattaagaaaggagaagatcgtatttctgtt
cttattccacagctacatagggataaagatgcatggggagacaatgtggaagaattccaa
cctgaacgatttgaagagctggataaggttcctcatcatgcttataagccatttggaaat
ggccagagagcatgtatcggtatgcaatttgcacttcatgaagccactcttgtaatggga
atgcttcttcaacattttgaattaatcgattatcaaaactatcagctggacgtaaaacaa
acattaacgctaaagcccggtgattttaagattaggattctaccccgaaaacaaactatt
agtcatcctactgttcttacacctacagaggacaagctgaaaaacgatgaaattaagcag
cacgttcagaagccaccttctattattggggccgataatctttcacttcttgttctgtac
ggctcggatacaggtgtagcagaaggtattgcaagagaattagcagatacagctagttta
gaaggagttcgaacggaagtggtagctcttaacgatcggattggaagtttgccaaaagaa
ggagcggttcttattgtaacttcttcttataatggaaaaccgccaagtaatgcaggacag
tttgtgcaatggttggaggaactaaaaccggatgagctaaaaggtgttcaatacgcagtt
tttggttgtggagatcataattgggctagtacctatcaacggattccaagatacattgat
gagcagatggctcaaaaaggagcaacaagattttctaaacgcggagaagcagatgcaagt
ggtgatttcgaggaacagcttgagcaatggaaacaaaacatgtggtctgatgcgatgaag
gcatttggattggagctcaacaaaaatatagaaaaagagcgcagtactttgagtctgcaa
tttgttagtcgtcttggaggatctcctcttgcacgaacatatgaagcagtttatgcatct
atactagaaaatcgtgaactccaatcacccagcagtgatagaagtacacgacatatcgag
gtatctttgccagaaggcgctacatataaagaaggagaccaccttggagtgttgccagtt
aatagcgagaaaaatatcaaccgaattttaaaacgttttggattaaatgggaaggatcaa
gttatactgagtgcaagtggacgaagtataaatcacatacctttagacagtcctgttagt
ttattggaccttcttagttatagtgttgaagttcaagaagctgccactcgagcacaaata
cgagaaatggtaacattcacagcatgtcctcctcataaaaaagaattggaagcattatta
gaagaaggagtttaccatgaacaaatactaaagaaacggatttcaatgttggaccttctt
gaaaagtatgaggcttgtgaaatccgatttgaacgctttttagaacttcttcctgcgctc
aaaccgcgttactattctatttcaagctctccactcgttgcacacaatcgtctgagcatt
acggtcggtgttgttaatgcgcctgcatggagtggggaagggacatatgaaggagtcgct
tctaattacttagctcagcgtcataataaagatgagattatctgtttcattcgaacgcca
caatcaaactttgaattacctaaagatccagaaacaccaattattatggttgggccaggt
actggaattgcaccattccgtggattcttgcaagcgcgtcgtgttcaaaagcaaaaaggt
attaacttaggacaagcgcatctatattttggttgtcgtcatcctgaaaaagattatctc
tatcgtacagaattagaaaatgatgaaagagatggattaatctctttacacacagctttt
tctcgtctagagggacatccaaaaacatatgtacagcatttaataaaacaagatagaatc
aatttaatttcgttattagataatggagctcatctttatatatgtggtgatggaagtaga
atggctccggatgtagaagataccctttgtcaagcatatcaagaaattcatgaagtcagt
gaacaagaagcaagaaattggttggatcgtgtgcaagatgaagggcgatatggaaaagat
gtttgggctggtatatga

DBGET integrated database retrieval system