KEGG   Bacillus thuringiensis serovar chinensis CT-43: CT43_CH3687Help
Entry
CT43_CH3687       CDS       T01838                                 

Definition
(GenBank) phosphoglycerate mutase
  KO
K01834  2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
btc  Bacillus thuringiensis serovar chinensis CT-43
Pathway
btc00010  Glycolysis / Gluconeogenesis
btc00260  Glycine, serine and threonine metabolism
btc00680  Methane metabolism
btc01100  Metabolic pathways
btc01110  Biosynthesis of secondary metabolites
btc01120  Microbial metabolism in diverse environments
btc01130  Biosynthesis of antibiotics
btc01200  Carbon metabolism
btc01230  Biosynthesis of amino acids
Module
btc_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
btc_M00002  Glycolysis, core module involving three-carbon compounds
btc_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:btc00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    CT43_CH3687
  Energy metabolism
   00680 Methane metabolism
    CT43_CH3687
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    CT43_CH3687
Enzymes [BR:btc01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.11  phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
     CT43_CH3687
Membrane trafficking [BR:btc04131]
 Autophagy
  Chaperone mediated autophagy (CMA)
   Selective cargos
    CT43_CH3687
Exosome [BR:btc04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   CT43_CH3687
  Exosomal proteins of melanoma cells
   CT43_CH3687
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: His_Phos_1 DUF1482
Motif
Other DBs
NCBI-ProteinID: AEA17353
Position
complement(3703463..3704038)
Genome map
AA seq 191 aa AA seqDB search
MSTYIYMVRHGESPKLEGNERMRGLTERGHMDARRVTDILKAERIDTFISSPYNRAMLTI
EESANFHEKEIVVYENLKECMFSSEDQVISDKEVYPLVQKMFSNPDFARTEGESYADCQR
RVVKVLKEILLDFQGRKIVIGTHGLVMTLMINYFDKQYGFEFLMNTSKPDIYKMEFKEEQ
LMNVERLWKEE
NT seq 576 nt NT seq  +upstreamnt  +downstreamnt
atgagcacatatatttatatggttagacatggtgaatcaccaaaactagaaggaaatgaa
agaatgcgcgggttaactgagaggggacatatggatgcccgtagagtaactgacatatta
aaagcggagaggattgatacttttatttccagtccttataatcgggctatgttaacgata
gaggagtcagctaatttccatgaaaaagaaatagtagtatatgaaaatcttaaagagtgt
atgttttcaagtgaggatcaggttatatcagacaaagaggtgtatccacttgtacagaag
atgttctctaatccagactttgcacgaacggaaggagagtcatatgcagattgccagaga
agagtagtgaaagtattaaaagaaatcttattggattttcaaggacgcaaaattgtaatt
ggtacacatgggcttgtcatgacattaatgataaattattttgataaacaatatggtttt
gaatttttaatgaatacgtcaaaaccggatatatataagatggagtttaaagaagaacaa
ttaatgaatgtggagagattatggaaagaggaataa

DBGET integrated database retrieval system