KEGG   Bacillus thuringiensis serovar chinensis CT-43: CT43_CH3687Help
Entry
CT43_CH3687       CDS       T01838                                 

Definition
phosphoglycerate mutase
Orthology
K01834  
2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
btc  Bacillus thuringiensis serovar chinensis CT-43
Pathway
Glycolysis / Gluconeogenesis
Glycine, serine and threonine metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Gluconeogenesis, oxaloacetate => fructose-6P
Class
Metabolism; Overview; Carbon metabolism [PATH:btc01200]
Metabolism; Overview; Biosynthesis of amino acids [PATH:btc01230]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:btc00010]
Metabolism; Energy metabolism; Methane metabolism [PATH:btc00680]
Metabolism; Amino acid metabolism; Glycine, serine and threonine metabolism [PATH:btc00260]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3703463..3704038)
Genome map
AA seq 191 aa AA seqDB search
MSTYIYMVRHGESPKLEGNERMRGLTERGHMDARRVTDILKAERIDTFISSPYNRAMLTI
EESANFHEKEIVVYENLKECMFSSEDQVISDKEVYPLVQKMFSNPDFARTEGESYADCQR
RVVKVLKEILLDFQGRKIVIGTHGLVMTLMINYFDKQYGFEFLMNTSKPDIYKMEFKEEQ
LMNVERLWKEE
NT seq 576 nt NT seq  +upstreamnt  +downstreamnt
atgagcacatatatttatatggttagacatggtgaatcaccaaaactagaaggaaatgaa
agaatgcgcgggttaactgagaggggacatatggatgcccgtagagtaactgacatatta
aaagcggagaggattgatacttttatttccagtccttataatcgggctatgttaacgata
gaggagtcagctaatttccatgaaaaagaaatagtagtatatgaaaatcttaaagagtgt
atgttttcaagtgaggatcaggttatatcagacaaagaggtgtatccacttgtacagaag
atgttctctaatccagactttgcacgaacggaaggagagtcatatgcagattgccagaga
agagtagtgaaagtattaaaagaaatcttattggattttcaaggacgcaaaattgtaatt
ggtacacatgggcttgtcatgacattaatgataaattattttgataaacaatatggtttt
gaatttttaatgaatacgtcaaaaccggatatatataagatggagtttaaagaagaacaa
ttaatgaatgtggagagattatggaaagaggaataa

DBGET integrated database retrieval system