KEGG   Bacillus thuringiensis serovar chinensis CT-43: CT43_CH3701Help
Entry
CT43_CH3701       CDS       T01838                                 

Definition
6-phospho-beta-glucosidase
Orthology
K01223  
6-phospho-beta-glucosidase [EC:3.2.1.86]
Organism
btc  Bacillus thuringiensis serovar chinensis CT-43
Pathway
Glycolysis / Gluconeogenesis
Brite
KEGG Orthology (KO) [BR:btc00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    CT43_CH3701
Enzymes [BR:btc01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.86  6-phospho-beta-glucosidase
     CT43_CH3701
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3717807..3719216)
Genome map
AA seq 469 aa AA seqDB search
MKFPHDFLFGAASASYQVEGAWNEDGKGVTNWDEFSKIPGKTYNGTNGDVAVDHYHRYKE
DVRLMAEMGLESYRFSISWARILPTGDGKVNEKGIEFYNNLIDECLKYGIVPFVTLYHWD
LPLPLEKDGGWTNKRTAEAFVKYAETCFKAFGDRVKHWITFNETVMFCGLGYLKGAHPPG
IQNDVPKYFQATHYVFYAHAKTVAVYKQLKQYGEIGITHVFLPAYSVDDQKENIRAANHA
NEYETYWYYDPILKGEYPSYVVQQLKEKGWTPNWTVEELEIIKQNAEENDFIGLNYYQPI
RVERYDMDIKSEEHSRENSTLAPGNPSFDGFYRTVKMDDKTYTKWGWEISPEGFLEGLHM
LKARYGDIKMYVTENGLGDEDPIIDGEIVDVPRIKFIEAHLKVMKRAIEEGINLKGYYAW
SVIDLLSWLNGYKKQYGFIFVDHNDNLKRKKKLSFHWYKRVIETRGEEL
NT seq 1410 nt NT seq  +upstreamnt  +downstreamnt
atgaagtttccacatgattttttattcggagctgcttcagcttcttatcaagtagaaggt
gcatggaatgaagatggaaaaggtgttacgaattgggacgagttttcaaaaattcctggc
aaaacatacaatggaacaaatggtgatgtagctgttgatcattatcatcgatataaggaa
gatgttcgcttaatggctgagatgggattagaatcgtatcgtttttctatttcttgggcg
agaatattgccgactggagatggaaaggtaaatgaaaaagggattgaattttataacaac
ttaattgatgaatgcttaaaatacgggattgtgccgtttgtcactttatatcattgggat
ttaccattaccgttagaaaaagatggtggatggacgaataaaagaacagcagaggctttc
gtaaaatatgcagaaacttgttttaaggcatttggtgacagagttaagcattggattact
tttaatgagacagtaatgttttgtggattaggttatttaaaaggtgcacatccaccagga
atccaaaatgatgttccaaagtattttcaagcgactcattatgtattttatgcacatgcg
aaaacagttgcggtgtacaagcagctgaaacaatatggtgagattgggattacacatgtt
ttcttacctgcttatagtgtggatgatcaaaaagaaaatatacgagcagcaaatcatgcg
aatgaatatgaaacgtattggtattatgatccaattttaaaaggcgagtatccgtcttat
gttgtacaacaattaaaggaaaaaggatggactcctaattggacggttgaagaattagaa
atcattaaacaaaatgcagaagaaaatgattttattggcttgaattattatcaaccaata
cgagtagaaagatacgatatggatataaagagtgaggaacattctcgagaaaactcaacg
cttgctccaggtaacccttcttttgatggtttttatcgaacagttaaaatggatgataaa
acatatacaaaatggggatgggaaatatctcccgaaggtttcttagagggattgcatatg
ttgaaagcgcgttacggtgacataaagatgtatgtaacggaaaatggacttggtgatgaa
gatccaatcattgacggagaaattgtagatgttccgagaattaaatttattgaagcgcat
ttaaaagtaatgaagcgtgcaattgaagagggaattaacttaaaaggttattatgcatgg
tcagtgattgatcttttaagttggttaaatggatataaaaagcaatatggctttattttt
gtcgatcataatgataacttaaaacgtaagaagaaactttcgtttcattggtataaacgt
gtgatcgaaacgagaggggaagagttataa

DBGET integrated database retrieval system