KEGG   Bacillus thuringiensis serovar chinensis CT-43: CT43_CH3915Help
Entry
CT43_CH3915       CDS       T01838                                 

Gene name
murE
Definition
UDP-N-acetylmuramoylalanyl-D-glutamate--2,6-diaminopimelate ligase
Orthology
K01928  
UDP-N-acetylmuramoyl-L-alanyl-D-glutamate--2,6-diaminopimelate ligase [EC:6.3.2.13]
Organism
btc  Bacillus thuringiensis serovar chinensis CT-43
Pathway
Lysine biosynthesis
Peptidoglycan biosynthesis
Class
Metabolism; Amino acid metabolism; Lysine biosynthesis [PATH:btc00300]
Metabolism; Glycan biosynthesis and metabolism; Peptidoglycan biosynthesis [PATH:btc00550]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3934877..3936352)
Genome map
AA seq 491 aa AA seqDB search
MKLHTLLSCLHDFPVVPKENPEITSIEADSRKVKEGSLFVCMKGYTVDSHDFAKQAAAQG
AAAIVAERPIDVDVPVVLVKNTFRSLAVLADYFYGQPTHKLHLIGITGTNGKTTTSHIMD
EIMRAHGHKTGLIGTINMKIGDETFEVKNTTPDALTLQQTFSKMVEQGVDSTVMEVSSHA
LDLGRVHGCDYDVAVFTNLTQDHLDYHKTMEEYKHAKGLLFAQLGNSYNHNREKYAVLNS
DDNVTEEYMRSTAATVVTYGIDTTSDIMAKNIVMTSGGTTFTLVTPYESVNVTMKLIGKF
NVYNVLAATAAGLVSGVKLETIIAVIKELAGVPGRFEVVDGGQNYTVIVDYAHTPDSLEN
VLKTAKQFAKGDVYCIVGCGGDRDRTKRPIMASVATKYATHAIYTSDNPRSEDPAAILDD
MVHGASGNNYEVIIDRKEAIHHAITKVKADDIIIIAGKGHETYQIIGKEVHHFDDREVAK
EAITRRLNNEE
NT seq 1476 nt NT seq  +upstreamnt  +downstreamnt
atgaagttgcatacacttttatcatgtttgcatgattttccagttgttccaaaagaaaat
ccagaaatcacatctatagaagctgattcacgtaaagtgaaagaaggaagcttatttgta
tgtatgaaaggatatacggttgatagccatgattttgctaagcaagcagcggcacaagga
gcggctgctattgttgcggaaagaccaattgatgttgacgttccagttgtacttgtgaaa
aatacttttcgttcgttagcggttttagctgattatttttatggtcaaccgacacacaag
ttacatttaatcggaattacaggtacaaatggaaagacaacaacatcgcatattatggat
gagattatgcgagcacatggtcataaaacagggctaattggaacgattaatatgaaaatc
ggtgatgaaacatttgaggtgaaaaatacaacaccagatgcactaacacttcaacagacg
ttttcaaaaatggttgaacaaggtgtggacagcacggtaatggaagtttcgtcacatgcg
ttagatcttggtcgtgtacacggatgtgattacgatgtagcggtgtttacgaacttaaca
caagatcatttagactatcataaaacgatggaagaatataaacatgcaaaagggttacta
tttgcacagcttggcaatagttataatcataatcgtgaaaagtacgctgtgctgaatagc
gatgataatgtaacagaagagtatatgagaagtactgcagcaactgttgtaacatatggt
attgatacaacaagtgacattatggcaaaaaatatcgttatgacgagtggcggaactaca
tttacccttgtcacaccgtatgaaagtgtaaatgttacgatgaaattaataggtaaattt
aatgtatataacgtacttgcagcaacagcagcaggacttgtttcgggtgtgaaattagaa
acaatcattgctgttataaaggaactagctggggttccagggcgttttgaagttgttgat
ggaggacaaaattatacagttattgttgattacgcacatacgccggatagtttagaaaat
gtattaaaaactgcaaaacaatttgcaaaaggtgatgtgtattgtatcgttggttgtggt
ggcgatagggaccgaacgaagagaccgataatggcaagtgttgcaacaaaatatgcaact
catgcaatttacacatcagataatccaagaagtgaagatccagcggctattttagatgat
atggtacatggtgcaagtggaaataattatgaagtgattattgatagaaaagaagcgata
caccatgcaatcactaaagtaaaagcagatgatatcattattattgctggtaagggtcat
gaaacgtatcaaattattggtaaagaagttcatcattttgatgatcgagaagttgcgaaa
gaagcaattacaaggcgtttaaacaacgaagagtaa

DBGET integrated database retrieval system