KEGG   Bacillus thuringiensis serovar chinensis CT-43: CT43_CH3976Help
Entry
CT43_CH3976       CDS       T01838                                 

Gene name
pdhC
Definition
(GenBank) branched-chain alpha-keto acid dehydrogenase subunit E2
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
btc  Bacillus thuringiensis serovar chinensis CT-43
Pathway
btc00010  Glycolysis / Gluconeogenesis
btc00020  Citrate cycle (TCA cycle)
btc00620  Pyruvate metabolism
btc01100  Metabolic pathways
btc01110  Biosynthesis of secondary metabolites
btc01120  Microbial metabolism in diverse environments
btc01130  Biosynthesis of antibiotics
btc01200  Carbon metabolism
Module
btc_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:btc00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    CT43_CH3976 (pdhC)
   00020 Citrate cycle (TCA cycle)
    CT43_CH3976 (pdhC)
   00620 Pyruvate metabolism
    CT43_CH3976 (pdhC)
Enzymes [BR:btc01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     CT43_CH3976 (pdhC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding Biotin_lipoyl_2 GCV_H NUP50
Motif
Other DBs
NCBI-ProteinID: AEA17639
Position
complement(3990465..3991754)
Genome map
AA seq 429 aa AA seqDB search
MAFEFKLPDIGEGIHEGEIVKWFIKPGDEVNEDDVLLEVQNDKAVVEIPSPVKGKVLEVL
VEEGTVAIVGDTLIKFDAPGYENLKFKGDDHDEAPKAEEAAVEAPAAEATPAATAEVVNE
RVIAMPSVRKYAREKGVDIHKVAGTGKNGRIVKADIDAFANGGQTVAATEAPAAVEATPA
AAKEEAPKAQPIPAGEYPETREKMSGIRKAIAKAMVNSKHTAPHVTLMDEVDVTELVAHR
KKFKAVAADKGIKLTYLPYVVKALTSALREYPMLNTSLDDASQEVVHKHYFNIGIAADTD
KGLLVPVVKDTDRKSIFTISNEINDLAGKAREGRLAPTEMKGASCTITNIGSAGGQWFTP
VINHPEVAILGIGRIAEKPVVKNGEIVAAPVLALSLSFDHRLIDGATAQKALNQIKRLLN
DPQLLVMEA
NT seq 1290 nt NT seq  +upstreamnt  +downstreamnt
gtggcatttgaatttaaactaccagatatcggtgaaggtatccacgaaggtgaaatcgta
aaatggtttattaaaccaggcgatgaagtaaatgaagacgatgtacttcttgaagtgcaa
aatgataaagcagtagtagaaatcccttctcctgttaaaggtaaagtacttgaagtactt
gtagaagaaggaacagttgcaatcgtaggagatacattaattaaatttgatgctcctgga
tacgaaaaccttaaatttaaaggtgacgatcatgatgaagctccaaaagctgaagaagca
gcagtagaagctccagcagcggaagctactccagcagcaactgcagaagtagtaaatgag
cgcgtaatcgctatgccatctgttcgtaaatacgctcgtgaaaaaggtgtagacattcat
aaagtggctggtactggtaagaacggccgtatcgtaaaagctgacatcgatgcatttgca
aatggtggacaaactgtagcagcaactgaggctccagcagcagtagaagctactccagca
gcagcgaaagaagaagcaccaaaagcacaaccaattccagctggtgaatatccagaaact
cgtgagaaaatgagtggtatccgtaaagcgattgcgaaagcaatggttaactctaagcat
acagctcctcacgtaacattaatggatgaagttgatgtaactgagcttgttgctcaccgt
aagaagttcaaagcagtagcagctgacaaaggtattaaattaacttaccttccatacgtt
gttaaagctttaacatctgcattacgtgaatacccaatgttaaacacttctttagacgat
gcatctcaagaagtagttcataaacattacttcaacatcggtatcgcagctgatacagac
aaaggtctattagtaccagttgttaaagatacagatcgcaagtctatcttcactatttct
aacgagatcaatgatcttgctggtaaagcacgtgaaggtcgtctagctccaactgaaatg
aaaggtgcttcttgcacaattacaaacattggttctgcaggtggacaatggttcactcca
gttatcaatcacccagaagtagcaatccttggtatcggccgtatcgctgaaaaaccagtt
gtgaaaaatggtgagatcgttgcagctccagtattagcattatctctaagctttgaccat
cgtttaattgacggcgcaactgctcaaaaagcgttaaaccaaattaaacgtctattgaat
gacccacaattattagtaatggaggcgtaa

DBGET integrated database retrieval system