KEGG   Bacillus thuringiensis serovar chinensis CT-43: CT43_CH4045Help
Entry
CT43_CH4045       CDS       T01838                                 

Definition
2-hydroxy-3-oxo-5-methylthiopent-2-enoate oxidase
Orthology
K08967  
1,2-dihydroxy-3-keto-5-methylthiopentene dioxygenase [EC:1.13.11.53 1.13.11.54]
Organism
btc  Bacillus thuringiensis serovar chinensis CT-43
Pathway
Cysteine and methionine metabolism
Metabolic pathways
Module
Methionine salvage pathway
Class
Metabolism; Amino acid metabolism; Cysteine and methionine metabolism [PATH:btc00270]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
4056569..4057081
Genome map
AA seq 170 aa AA seqDB search
MAQIHIHEVNTRIENEVEVSKFLQEEGVLYEKWNISKLPTHLNENYSLTDENKAEILAVF
SKEIADVSARRGYKAHDVISLSNSTPNLDELLINFQKEHHHTDDEVRFIVSGHGIFAIEG
KDGKFFDVELEPGDLISVPENARHYFTLQDDRQVVAIRIFVTTEGWVPIY
NT seq 513 nt NT seq  +upstreamnt  +downstreamnt
atggcgcaaattcatattcatgaagtaaatactcgtattgaaaatgaagtggaagtatct
aaatttctacaagaggaaggcgttttatatgagaaatggaatatttctaaacttcctact
catttaaatgaaaattattctttaacagatgaaaacaaagctgaaatattagctgttttt
tcaaaagaaatcgctgatgtttcagcacgtcgaggttataaagcacatgatgtaatttca
ctttcaaatagcacacctaaccttgacgaattattaattaatttccaaaaagaacatcat
catacagacgacgaagtccgctttatcgtcagtggtcatggcattttcgctattgaaggc
aaagatgggaaattctttgatgttgaacttgagccaggcgatctaatatctgttccagaa
aatgcaagacattattttaccttgcaagatgatcgtcaagttgtagctattcgtattttt
gtaacaactgaaggctgggttccaatctattaa

DBGET integrated database retrieval system