KEGG   Bacillus thuringiensis serovar chinensis CT-43: CT43_CH4279Help
Entry
CT43_CH4279       CDS       T01838                                 

Gene name
glcK
Definition
(GenBank) glucokinase
  KO
K00845  glucokinase [EC:2.7.1.2]
Organism
btc  Bacillus thuringiensis serovar chinensis CT-43
Pathway
btc00010  Glycolysis / Gluconeogenesis
btc00052  Galactose metabolism
btc00500  Starch and sucrose metabolism
btc00520  Amino sugar and nucleotide sugar metabolism
btc00521  Streptomycin biosynthesis
btc01100  Metabolic pathways
btc01110  Biosynthesis of secondary metabolites
btc01120  Microbial metabolism in diverse environments
btc01130  Biosynthesis of antibiotics
btc01200  Carbon metabolism
Module
btc_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
btc_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:btc00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    CT43_CH4279 (glcK)
   00052 Galactose metabolism
    CT43_CH4279 (glcK)
   00500 Starch and sucrose metabolism
    CT43_CH4279 (glcK)
   00520 Amino sugar and nucleotide sugar metabolism
    CT43_CH4279 (glcK)
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    CT43_CH4279 (glcK)
   00524 Neomycin, kanamycin and gentamicin biosynthesis
    CT43_CH4279 (glcK)
Enzymes [BR:btc01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     CT43_CH4279 (glcK)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ROK BcrAD_BadFG FtsA
Motif
Other DBs
NCBI-ProteinID: AEA17941
Position
complement(4255532..4256515)
Genome map
AA seq 327 aa AA seqDB search
MEEKWLVGVDLGGTTIKLAFINVYGEILHKWEIPTNTGEQGKHITLDVAKAIDKKLEELG
ELKSKLIGIGMGAPGPVHVASGMIYEAVNLGWKNYPLKDLLEVETGLPVVIDNDANLAAL
GEMWKGAGEGAKDLICMTLGTGVGGGVIANGEIVHGVSGAAGEIGHITVVTENAFPCNCG
KSGCLETVASATGIVRVAMQKIQETNKESMLRSMLAEEGRITSKDVFEALGQGDELAGEV
VEKVASYLGLAVANLSSTLNPEKIVIGGGVSKAGDALLEPIQRYFEQYAFSRAVKSTKLA
IATLGNDAGVIGGAWLVKKHKYEAKMI
NT seq 984 nt NT seq  +upstreamnt  +downstreamnt
atggaagagaaatggttagttggtgttgaccttggtggtacaacgattaaattagcattt
attaatgtatacggtgaaattttacataagtgggaaatccctacaaatacaggtgagcaa
ggaaaacatattacacttgatgttgcgaaagcaattgataaaaagctagaagaattaggc
gaattgaagagcaagttaattggtattggtatgggagctcctggccctgtacatgtggca
tctggaatgatttatgaagcggttaatttagggtggaaaaactatccgctaaaagattta
ttagaagtagaaacaggattacctgttgttattgataatgatgcaaacttagcagcgctt
ggtgaaatgtggaaaggtgctggtgaaggtgcaaaagatttaatctgcatgacacttggt
acgggcgttggtggtggtgtaatcgccaatggtgagattgtacacggcgtgagtggtgct
gctggtgagattggacatattacagtagttacagaaaatgctttcccatgtaattgcggg
aagtctggttgcttagaaacagtagcatctgcgacaggtattgtacgtgttgctatgcaa
aaaatacaagagactaataaagaaagcatgttgcgttctatgttagctgaagaaggacgt
attacatcaaaagatgtctttgaagcacttggacaaggtgatgaattagcaggcgaagta
gtagaaaaggtagcttcttatttagggttagctgtagcgaacctatctagtacgttgaac
ccagagaaaattgttattggtggaggcgtgtctaaagctggagatgcgctattagaacca
attcaacgctatttcgagcaatacgctttctcacgtgctgtaaagagcacgaagttagct
attgcaacacttggtaatgatgcaggtgttatcggaggagcttggcttgtaaaaaagcac
aaatacgaagcgaagatgatataa

DBGET integrated database retrieval system