KEGG   Bacillus thuringiensis serovar chinensis CT-43: CT43_CH4411Help
Entry
CT43_CH4411       CDS       T01838                                 

Definition
exodeoxyribonuclease V subunit alpha
Orthology
K03581  
exodeoxyribonuclease V alpha subunit [EC:3.1.11.5]
Organism
btc  Bacillus thuringiensis serovar chinensis CT-43
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:btc00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    CT43_CH4411
Enzymes [BR:btc01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.11  Exodeoxyribonucleases producing 5'-phosphomonoesters
    3.1.11.5  exodeoxyribonuclease V
     CT43_CH4411
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(4374585..4376921)
Genome map
AA seq 778 aa AA seqDB search
MGNQHAMDLFEEEKKFIKAQVLHTIFHNEENLYSVVSMKVIETNETYDEKKVMINGHFPR
MHEDEVFTLTGHFKDHPKYGKQYMVETFKKELPQTKAGMVQYLASDLFKGIGKRTAEKIV
DHLGEHAISKIMDDPEALNGVVNKQKAQEIYETIVEHQGLEKVMSFLNGYGFGTKLSIKI
YQQYKEMTLEVIRNNPYQLIEEVDGIGFGRADDIGRALGISGNHDDRVRAGCFYTLENVS
LQLGHVYMRKDQLVRETMSLLNNQEGRVTEEDIIGCIETMQSEGKVIIEEERVYLATLFY
SEKGVVKSIRRLMNQEETPSFPEAEVLKTLGEIEEQLNVQYAPFQQEAIQTALHKPMMLL
TGGPGTGKTTVIKGIVEMYASLHGLSLNPNEYSDDNPFPILLTAPTGRAAKRMSESTGLP
ACTIHRLLGWTPEGSFQRNETDPVQGKLLIIDEFSMVDIWLANQLFKSLPTNIQVIVVGD
EDQLPSVGPGQVLKDLLNAGAVPTVKLTEIYRQAEGSSVIQLAHAIKDGTLPPDLAQNKK
DRSFISCTGAQIVEVVKKVCENAKTKGFSARDVQVLAPMYRGPAGINVLNEALQQVFNPK
REKSKEIQYGDVVYRRGDKVLQLVNQPESQVFNGDIGEIVSVFYAKENVEQQDMIIVSFD
GIEVTYTKPDLNQITHAYCCSIHKSQGSEFPIVIMPIVKSYNRMLRRNLIYTGITRSKKF
LIICGEEVAFQSGVNRLDDAMRQTTLASRLQESQGEVQMVTVNGEEMDVENISPYDFM
NT seq 2337 nt NT seq  +upstreamnt  +downstreamnt
atgggaaatcaacatgcaatggatttgtttgaggaagagaaaaaatttataaaagcgcaa
gttcttcataccattttccacaacgaagaaaacctctattccgttgtcagtatgaaagtc
attgaaacgaatgaaacgtatgacgaaaagaaagtaatgataaacggtcattttccccgc
atgcatgaagatgaagtgtttacattgacaggtcactttaaggaccatccaaagtatgga
aaacaatatatggttgaaacatttaaaaaagaattgccgcaaacaaaagcaggtatggtg
caatatttagcgagtgatttatttaaagggataggaaagcgtacagcggaaaaaattgtg
gatcatctcggggaacatgctatttctaaaattatggatgaccctgaggcgttaaatggt
gttgttaacaaacaaaaggctcaggaaatatatgagacaattgttgaacatcaaggatta
gaaaaagtaatgagctttttaaatggttacggttttggaacgaaactttctattaagatt
taccagcaatataaagagatgacattagaagtgattcgtaataatccgtatcaacttatt
gaagaagtggacgggattggttttggacgagcggatgatatagggcgtgcgttagggata
tcgggtaatcacgacgaccgtgtacgagcgggatgtttttacacattagagaatgtctca
ttgcaacttggtcacgtttatatgaggaaagatcaacttgtaagagaaacgatgtcactt
ttaaacaatcaagaaggaagagtgactgaagaagatattataggttgtattgaaacgatg
caaagtgaagggaaagttatcatagaagaagaacgagtgtatttagcaactttattctac
tctgaaaaaggtgttgtaaagtctattcgtcgattgatgaatcaagaggaaacaccttca
tttcctgaagcagaagtgttaaaaacattaggtgaaattgaagaacagttgaatgtacaa
tatgcaccgtttcagcaagaagcgattcaaacggcacttcataaaccgatgatgttatta
acaggtggaccaggaacaggaaaaacaaccgttattaaagggattgttgaaatgtatgcg
tcacttcacggattatcgttaaatccgaatgaatacagtgatgataatccatttccaata
ctattaacagctccaacaggaagagcagcgaagcggatgagtgaatcgacaggacttcca
gcttgcacaattcaccgtttgcttggctggacgccagaaggatctttccagcgtaatgaa
acggatcctgtccaaggtaagctccttattatcgatgaattttcaatggttgatatttgg
ctcgcaaatcagctatttaagtcgctaccaacgaatattcaagttatcgttgtaggtgat
gaagatcagttgccatctgtaggacctggacaagtattaaaagatttattaaatgcaggt
gcagttccgacagtgaagcttactgaaatttatcgtcaagcagaaggctcatctgttatt
caacttgcccatgcgatcaaagacggcacactcccgccagatttagcgcaaaataaaaaa
gatcgttcgtttatcagctgtacaggggctcaaattgttgaggttgtgaaaaaagtttgc
gaaaacgctaaaacaaaaggctttagtgcaagggatgttcaagtattagcaccgatgtac
cgcgggcctgctggtattaatgtattaaacgaagcgctgcaacaagtatttaacccgaaa
agggaaaagagtaaagaaatccagtacggtgatgttgtataccgaagaggcgataaagta
ctgcaactcgttaatcagccggagagccaagtgtttaatggggatatcggagaaattgtt
tcggtgttttatgcgaaagaaaacgttgagcaacaagatatgattatcgtttcatttgat
ggaattgaggtaacgtatacaaagccggatttaaatcaaattacacatgcatattgttgt
tcgattcataaatcacaaggtagtgaatttccgattgttattatgccgattgtgaaaagt
tacaaccgtatgttacgccgtaatttaatttacacgggcattacaagaagtaagaagttc
cttattatttgcggggaggaagtagctttccaatctggtgtaaatcgccttgatgatgca
atgcgtcaaacaactttagctagtcgcttgcaggaatcacaaggagaagtacagatggtc
acagttaatggcgaggaaatggacgtggaaaacatttcaccgtatgatttcatgtaa

DBGET integrated database retrieval system