KEGG   Bacillus thuringiensis serovar chinensis CT-43: CT43_CH4437Help
Entry
CT43_CH4437       CDS       T01838                                 

Gene name
ruvA
Definition
Holliday junction DNA helicase motor
Orthology
K03550  
holliday junction DNA helicase RuvA [EC:3.6.4.12]
Organism
btc  Bacillus thuringiensis serovar chinensis CT-43
Pathway
Homologous recombination
Class
Genetic Information Processing; Replication and repair; Homologous recombination [PATH:btc03440]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(4404547..4405164)
Genome map
AA seq 205 aa AA seqDB search
MFEYVTGYVEYVGPEYVVIDHNGIGYQIFTPNPYVFQRSKQEIRVYTYHYVREDIMALYG
FKTREERLLFTKLLGVSGIGPKGALAILASGQTGQVVQAIEHEDEKFLVKFPGVGKKTAR
QMILDLKGKLADVVPDAFVDLFSDTERFDEKKGSSAELDEALEALRALGYAEREVSRVVP
ELLKESLTTDQYIKKALSLLLNGKR
NT seq 618 nt NT seq  +upstreamnt  +downstreamnt
ttgtttgaatatgttacaggttacgtggagtatgtagggccggaatatgtcgtaattgac
cataatggaattggttatcaaattttcacaccgaatccgtatgtatttcaaagaagtaag
caagaaatccgtgtctatacatatcattatgtgagagaagatattatggcactttacggg
tttaaaacacgtgaagagcgtttattatttacaaagttgttaggcgtgtctggcattggg
ccaaaaggcgctcttgcaattttagcttctggtcaaacaggacaggtcgttcaagcgatt
gagcatgaagatgagaagtttttagtgaaattcccaggcgtcggaaagaaaacagcacgc
caaatgattttagatttaaaaggaaaactagcagatgtcgtaccagatgcatttgtggat
ttattctcagacacagaacgttttgatgagaagaaaggttcatcagctgagcttgatgag
gcactggaagctctgcgcgcacttggatacgcagaacgcgaagtttctcgcgttgtacca
gagttattaaaagaatcattaacgacggatcagtatattaaaaaggcacttagtctttta
ctaaatggtaagaggtga

DBGET integrated database retrieval system