KEGG   Bacillus thuringiensis serovar chinensis CT-43: CT43_CH4543Help
Entry
CT43_CH4543       CDS       T01838                                 

Definition
enoyl-CoA hydratase
Orthology
K13767  
enoyl-CoA hydratase [EC:4.2.1.17]
Organism
btc  Bacillus thuringiensis serovar chinensis CT-43
Pathway
Fatty acid degradation
Metabolic pathways
Fatty acid metabolism
Brite
KEGG Orthology (KO) [BR:btc00001]
 Metabolism
  Overview
   01212 Fatty acid metabolism
    CT43_CH4543
  Lipid metabolism
   00071 Fatty acid degradation
    CT43_CH4543
Enzymes [BR:btc01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     CT43_CH4543
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(4509795..4510571)
Genome map
AA seq 258 aa AA seqDB search
MLKFLSVRVEDHIAVATLNHAPANAMSSQVMHDVTELIDQVEKDDNIRVVVIHGEGRFFS
AGADIKEFTSVTEAKQATELAQLGQVTFERVEKCSKPVIAAIHGAALGGGLEFAMSCHMR
FATESAKLGLPELTLGLIPGFAGTQRLPRYVGKAKACEMMLTSTPITGAEALKWGLVNGL
FSEESFLDDTLKVAKQIAGKSPATTRAVLELLQTTKSSHYYEGVQRESQIFGEVFTSEDG
REGVAAFLEKRKPSFSGR
NT seq 777 nt NT seq  +upstreamnt  +downstreamnt
atgttgaaattcctatctgtaagagttgaagatcatatcgcggtggcgacgttaaatcac
gcaccagcgaatgcgatgtcttcacaagttatgcatgacgttactgaattaattgatcaa
gtggaaaaggatgataacattcgtgttgttgttattcacggtgaaggacgtttcttctca
gcaggagcagatattaaagaatttacatctgttactgaagcgaagcaagcaacagaatta
gcacagcttggacaagttacgtttgagcgtgttgaaaaatgttcaaaaccagttattgcg
gcaattcatggagcggcactgggcggcggccttgagtttgctatgtcttgccacatgcgc
tttgcaactgaaagtgcaaaacttggtttacctgaattaacacttggattaattcctggc
tttgcaggtacacagcgcttaccacgttatgttgggaaagcgaaagcttgtgaaatgatg
ttaacaagtacaccaattactggtgcagaagcattaaagtggggacttgttaacggattg
ttctctgaagaatcatttttagatgatacgcttaaagttgcaaaacaaattgctggaaaa
agtccagcaacaactcgtgctgtactagagttattgcaaacgacaaaatcgtctcattac
tatgaaggtgtacaacgtgaatcacaaatttttggtgaagtatttacgagtgaagatgga
agagaaggtgtagccgcatttttagaaaagcgtaaaccttcatttagtggcaggtag

DBGET integrated database retrieval system