KEGG   Bacillus thuringiensis serovar chinensis CT-43: CT43_CH4619Help
Entry
CT43_CH4619       CDS       T01838                                 

Gene name
pfkA
Definition
6-phosphofructokinase
Orthology
K00850  
6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
btc  Bacillus thuringiensis serovar chinensis CT-43
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:btc00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    CT43_CH4619 (pfkA)
   01230 Biosynthesis of amino acids
    CT43_CH4619 (pfkA)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    CT43_CH4619 (pfkA)
   00030 Pentose phosphate pathway
    CT43_CH4619 (pfkA)
   00051 Fructose and mannose metabolism
    CT43_CH4619 (pfkA)
   00052 Galactose metabolism
    CT43_CH4619 (pfkA)
  Energy metabolism
   00680 Methane metabolism
    CT43_CH4619 (pfkA)
Enzymes [BR:btc01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     CT43_CH4619 (pfkA)
Protein phosphatases and associated proteins [BR:btc01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     CT43_CH4619 (pfkA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(4588310..4589269)
Genome map
AA seq 319 aa AA seqDB search
MKRIGVLTSGGDSPGMNAAIRAVVRKAIFHDIEVYGIYHGYAGLISGHIEKLELGSVGDI
IHRGGTKLYTARCPEFKDPEVRLKGIEQLKKHGIEGLVVIGGDGSYQGAKKLTEQGFPCV
GVPGTIDNDIPGTDFTIGFDTALNTVIDAIDKIRDTATSHERTYVIEVMGRHAGDIALWA
GLADGAETILIPEEEYDMDDVIARLKRGSERGKKHSIIVVAEGVGSAIDIGKHIEEATNF
DTRVTVLGHVQRGGSPSAQDRVLASRLGARAVELLIAGRGGRCVGIQDNKLVDHDIIEAL
AQKHTIDKDMYQLSKELSI
NT seq 960 nt NT seq  +upstreamnt  +downstreamnt
atgaaacgtattggtgtattaacaagtggtggagattcacctggtatgaatgctgccatt
cgtgcagttgttcgtaaagcgattttccatgatattgaagtatatggtatttaccatgga
tacgctggattaatttctggtcacattgaaaaattagaacttggttctgttggcgatatt
atccaccgcggtggtacgaaattatatacagcaagatgtcctgagtttaaagacccagaa
gtacgactaaaaggtatcgagcaattaaagaaacatggtatcgaaggacttgttgttatt
ggtggagatggttcttaccaaggcgctaaaaaattaactgaacaaggattcccatgtgtt
ggtgtaccaggtacaatcgacaatgatatccctggaacagacttcacaattggtttcgat
acagctttaaacactgttattgatgcaattgataaaatccgtgacacagctacatctcat
gaacgtacatatgttatcgaagtaatgggacgtcacgctggtgatatcgcattatgggct
ggtttagctgatggtgcagaaacaatcttaattccagaagaagagtatgacatggatgat
gttatcgctcgtctgaagcgcggtagtgaacgtggtaaaaaacacagtattattgttgta
gctgaaggtgttggaagtgcaattgacatcggtaagcacattgaagaagcaacaaacttt
gatactcgtgtaactgtattaggtcacgtacaacgtggcggatcaccaagtgcacaagac
cgtgtattagcaagtcgtcttggcgcaagagcagttgaattattaattgctggtagaggt
ggacgttgtgtaggtattcaagataacaaacttgttgatcatgatattatcgaagcgtta
gctcaaaagcatacaatcgataaagatatgtatcaattatctaaagaattatccatctaa

DBGET integrated database retrieval system