KEGG   Bacillus thuringiensis serovar chinensis CT-43: CT43_CH4667Help
Entry
CT43_CH4667       CDS       T01838                                 

Definition
(GenBank) Acetyl-coenzyme A synthetase
  KO
K01895  acetyl-CoA synthetase [EC:6.2.1.1]
Organism
btc  Bacillus thuringiensis serovar chinensis CT-43
Pathway
btc00010  Glycolysis / Gluconeogenesis
btc00620  Pyruvate metabolism
btc00640  Propanoate metabolism
btc00680  Methane metabolism
btc01100  Metabolic pathways
btc01110  Biosynthesis of secondary metabolites
btc01120  Microbial metabolism in diverse environments
btc01130  Biosynthesis of antibiotics
btc01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:btc00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    CT43_CH4667
   00620 Pyruvate metabolism
    CT43_CH4667
   00640 Propanoate metabolism
    CT43_CH4667
  Energy metabolism
   00680 Methane metabolism
    CT43_CH4667
Enzymes [BR:btc01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.1  acetate---CoA ligase
     CT43_CH4667
Lipid biosynthesis proteins [BR:btc01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   CT43_CH4667
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AMP-binding AMP-binding_C
Motif
Other DBs
NCBI-ProteinID: AEA18327
Position
complement(4627403..4628989)
Genome map
AA seq 528 aa AA seqDB search
MKREELLAPPSYNLVSEIEKYTDDKEKLALIWQDDKGNRREVTYFELMQGANKIGNAFIK
SGLQKGDKLLIMMPRLIEAYMTYIAAIKAGFVVIPSSEMLRKKDIEYRIGHGEVKAIVSY
EPYIGQFDDIEAMESLQKFVLSEQSVDGWINLKTALETESDMLEMAKTDKEDMVFLSYTS
GTTGNPKGVVHTHAWAYAHLRTSAPNWLGIEENDVVWATASPGWQKWIWSPFLATLGSGA
TGFVYNGKFEPKTYLNLLDDNKVNVLCCTPTEYRLMAKVEDLSQYNLEALHSAVSAGEPL
NREVIGTFQKHFDITVRDGYGQTENTLLVGVMKGMDIRPGSMGKPTPGNHVDIVNEEGIP
VKVGEVGDIAVHIETPALFKQYYKDDERTAMQFRGDYYITGDKAKKDEDGYFWFEGRGDD
IIISSGYTIGPFEVEDALVKHPYVRECAVVASPDEIRGSVVKAFIVLRENIEKNEEILIP
TLQQHVKELTAPYKYPRKIEFVDELPKTISGKIRRIELRKQEMEIPSK
NT seq 1587 nt NT seq  +upstreamnt  +downstreamnt
atgaagagagaggaattgttggcaccaccatcttataatttagtttcagaaatagagaaa
tatacagacgataaagagaagcttgctttaatttggcaagatgataaagggaatagacga
gaagttacatattttgaattaatgcaaggtgcaaataaaattggaaacgcttttataaaa
agtggcttacaaaaaggggacaagctccttattatgatgccgcgcttaattgaggcttac
atgacgtatattgctgcgattaaagcaggatttgttgtaattccgagttcggaaatgttg
cgtaaaaaagatatcgaatatcgaattggacatggcgaagtaaaagcgatagtaagctat
gagccgtacattggacagtttgatgatatagaagcaatggaatctcttcaaaaattcgtc
ctgagcgagcagtcagtagacggatggatcaatttaaaaacagcattagaaacagaaagt
gacatgttagaaatggcgaaaacagataaagaagatatggtctttttatcttacacgtca
gggacgacaggaaacccgaaaggtgtcgttcatacgcacgcgtgggcatacgctcattta
cgtacaagcgccccaaattggctcggaattgaagagaatgatgttgtatgggcaacggct
agtccagggtggcaaaagtggatttggagcccgtttttagcaactctcggttcaggggca
acaggatttgtgtacaacggcaagtttgaaccgaaaacgtatttaaatttattagacgat
aataaggtgaatgtgctttgttgtacaccgactgagtatagattaatggcaaaggtagaa
gatttaagtcagtacaatttagaggcgttacatagcgctgtatccgcaggtgagccgtta
aatagagaagtcattggaacattccaaaagcactttgatattacagtaagagacggctat
gggcaaacggaaaatacactacttgttggtgtaatgaaagggatggatattagaccagga
tcaatggggaaaccaacgccaggtaaccacgtcgatatcgtaaatgaggaaggtattcca
gttaaagtaggcgaagttggtgatattgcagttcacattgaaacgccggcactctttaaa
caatattataaagacgatgagcgtacagcgatgcaattccgcggtgattattatattaca
ggtgataaagcgaagaaagatgaagacggctacttctggtttgaagggcgcggtgatgat
atcattattagctctggttatacaatcgggccgtttgaagtagaggatgcgcttgtaaaa
catccttacgtaagagaatgtgcggttgtcgcaagtcctgatgaaattcgcggaagtgtc
gtgaaggcatttatcgtattaagagagaatatagaaaagaacgaagaaatattaattcca
acactccaacaacacgtcaaagaactcactgcaccatataaataccctcgcaaaattgaa
tttgtagatgagctaccaaaaacgatttctggaaaaattcgccgtattgaacttagaaaa
caagagatggagattccgtcaaaataa

DBGET integrated database retrieval system