KEGG   Bacillus thuringiensis serovar chinensis CT-43: CT43_CH4726Help
Entry
CT43_CH4726       CDS       T01838                                 

Definition
dipeptidase PepV
Orthology
K01439  
succinyl-diaminopimelate desuccinylase [EC:3.5.1.18]
Organism
btc  Bacillus thuringiensis serovar chinensis CT-43
Pathway
Lysine biosynthesis
Metabolic pathways
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:btc00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    CT43_CH4726
  Amino acid metabolism
   00300 Lysine biosynthesis
    CT43_CH4726
Enzymes [BR:btc01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.18  succinyl-diaminopimelate desuccinylase
     CT43_CH4726
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(4684388..4685794)
Genome map
AA seq 468 aa AA seqDB search
MSAINWTEEVAKRKDDLIRDTQQFLQIKSVWEEESAKEGTPFGEGVEKALSFMLHKGEAE
GFASKNLEGYAGHLEMGQGEELVGILCHVDVVPEGDGWTTPAYSADIRDGKIFARGAIDD
KGPTMAAYYAMKIVKELGLPLSKRVRMIIGTDEESNWKCVDHYFKNEEMPTIGFAPDADF
PIINAEKGISDIQVVQNGSEEKKGTYELVSFDSGRRLNMVPDFAEAVITGEDVNALTVAY
EEYLQTAKKIGKSTIEGNTVTLQIEGISAHGSTPEKGENAGLLLANFLTTVSLDGKATAF
ATFATETFTGDIFGEKATIAYKDEISGPLTVNVGRLSYKKENGGNLGLNVRYPVTTNFEE
MIAKLKEYVGTYGFAVADYSNSRPHHVDKDHELIRTLQRVYEEQTGEKAELLAIGGGTYA
RSLKAGVAFGPLFPGKEELAHQKDEYIEIEDLLKATAIYAQAIHELAK
NT seq 1407 nt NT seq  +upstreamnt  +downstreamnt
atgtcagcgattaattggactgaagaagttgcaaaacgaaaagatgatttaattcgtgat
acacaacaatttttacaaattaaaagtgtatgggaagaagaatcggcgaaagaaggcaca
ccattcggtgaaggtgtagaaaaagcgctatctttcatgttacataaaggagaagctgaa
ggttttgcttctaaaaatttagaaggatatgcaggtcatcttgaaatgggacaaggagaa
gagttagtaggtattctttgtcacgttgatgttgtaccagaaggagatggctggacgact
cctgcgtatagtgcggatattcgcgacggaaagatttttgcacgtggtgcaattgacgat
aaaggcccaacgatggcagcatattatgcgatgaaaattgtgaaagaattaggcttacct
ctttcaaaacgtgttcgtatgattataggaacagatgaggaaagcaattggaaatgtgta
gatcactactttaaaaacgaagaaatgccaacaatcggttttgcaccagatgcagacttt
ccaattattaatgcagaaaaaggaatttctgatatacaagttgtgcaaaatggtagtgaa
gagaaaaaaggtacatatgaacttgtttcatttgattcagggcgtcgtttaaatatggtt
cctgattttgcagaagcggttattacaggagaagatgtaaatgcacttacagtagcatat
gaagagtatttacaaactgctaaaaaaatagggaaatcgactatagaaggcaatacagta
acgttgcaaatagaaggaatttcagcgcacggatctactcctgaaaaaggagaaaatgca
ggtttattattagcaaacttcttaactacagtttcacttgatggaaaagcaactgcattt
gcgacatttgcaacagaaacatttactggtgatatttttggtgaaaaagctactattgct
tataaagatgaaattagcggtccattaacagtgaatgttggtcgcctttcttataagaaa
gagaatggtggtaatttaggattaaacgtacgttacccagttacgactaactttgaagaa
atgattgcaaagttaaaagaatatgtaggtacgtatggatttgcagtagcagactattct
aactctcgtccgcatcacgttgataaagatcacgagttaattcgtacgttgcaacgtgta
tatgaggaacaaacaggtgaaaaagctgaattgttagcaatcggcggaggtacttatgct
cgctcattaaaagctggtgtggcatttggaccgctattccctggaaaagaagaacttgcg
catcaaaaagatgagtacattgaaattgaagacttattaaaagcaacagcaatttatgcg
caagcaattcatgaactagcgaagtaa

DBGET integrated database retrieval system