KEGG   Bacillus thuringiensis serovar chinensis CT-43: CT43_CH4726Help
Entry
CT43_CH4726       CDS       T01838                                 

Definition
dipeptidase PepV
Orthology
K01439  
succinyl-diaminopimelate desuccinylase [EC:3.5.1.18]
Organism
btc  Bacillus thuringiensis serovar chinensis CT-43
Pathway
Lysine biosynthesis
Metabolic pathways
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:btc01230]
Metabolism; Amino acid metabolism; Lysine biosynthesis [PATH:btc00300]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(4684388..4685794)
Genome map
AA seq 468 aa AA seqDB search
MSAINWTEEVAKRKDDLIRDTQQFLQIKSVWEEESAKEGTPFGEGVEKALSFMLHKGEAE
GFASKNLEGYAGHLEMGQGEELVGILCHVDVVPEGDGWTTPAYSADIRDGKIFARGAIDD
KGPTMAAYYAMKIVKELGLPLSKRVRMIIGTDEESNWKCVDHYFKNEEMPTIGFAPDADF
PIINAEKGISDIQVVQNGSEEKKGTYELVSFDSGRRLNMVPDFAEAVITGEDVNALTVAY
EEYLQTAKKIGKSTIEGNTVTLQIEGISAHGSTPEKGENAGLLLANFLTTVSLDGKATAF
ATFATETFTGDIFGEKATIAYKDEISGPLTVNVGRLSYKKENGGNLGLNVRYPVTTNFEE
MIAKLKEYVGTYGFAVADYSNSRPHHVDKDHELIRTLQRVYEEQTGEKAELLAIGGGTYA
RSLKAGVAFGPLFPGKEELAHQKDEYIEIEDLLKATAIYAQAIHELAK
NT seq 1407 nt NT seq  +upstreamnt  +downstreamnt
atgtcagcgattaattggactgaagaagttgcaaaacgaaaagatgatttaattcgtgat
acacaacaatttttacaaattaaaagtgtatgggaagaagaatcggcgaaagaaggcaca
ccattcggtgaaggtgtagaaaaagcgctatctttcatgttacataaaggagaagctgaa
ggttttgcttctaaaaatttagaaggatatgcaggtcatcttgaaatgggacaaggagaa
gagttagtaggtattctttgtcacgttgatgttgtaccagaaggagatggctggacgact
cctgcgtatagtgcggatattcgcgacggaaagatttttgcacgtggtgcaattgacgat
aaaggcccaacgatggcagcatattatgcgatgaaaattgtgaaagaattaggcttacct
ctttcaaaacgtgttcgtatgattataggaacagatgaggaaagcaattggaaatgtgta
gatcactactttaaaaacgaagaaatgccaacaatcggttttgcaccagatgcagacttt
ccaattattaatgcagaaaaaggaatttctgatatacaagttgtgcaaaatggtagtgaa
gagaaaaaaggtacatatgaacttgtttcatttgattcagggcgtcgtttaaatatggtt
cctgattttgcagaagcggttattacaggagaagatgtaaatgcacttacagtagcatat
gaagagtatttacaaactgctaaaaaaatagggaaatcgactatagaaggcaatacagta
acgttgcaaatagaaggaatttcagcgcacggatctactcctgaaaaaggagaaaatgca
ggtttattattagcaaacttcttaactacagtttcacttgatggaaaagcaactgcattt
gcgacatttgcaacagaaacatttactggtgatatttttggtgaaaaagctactattgct
tataaagatgaaattagcggtccattaacagtgaatgttggtcgcctttcttataagaaa
gagaatggtggtaatttaggattaaacgtacgttacccagttacgactaactttgaagaa
atgattgcaaagttaaaagaatatgtaggtacgtatggatttgcagtagcagactattct
aactctcgtccgcatcacgttgataaagatcacgagttaattcgtacgttgcaacgtgta
tatgaggaacaaacaggtgaaaaagctgaattgttagcaatcggcggaggtacttatgct
cgctcattaaaagctggtgtggcatttggaccgctattccctggaaaagaagaacttgcg
catcaaaaagatgagtacattgaaattgaagacttattaaaagcaacagcaatttatgcg
caagcaattcatgaactagcgaagtaa

DBGET integrated database retrieval system