KEGG   Bacillus thuringiensis serovar chinensis CT-43: CT43_CH4780Help
Entry
CT43_CH4780       CDS       T01838                                 

Definition
lysophospholipase L2
Orthology
K01048  
lysophospholipase [EC:3.1.1.5]
Organism
btc  Bacillus thuringiensis serovar chinensis CT-43
Pathway
Glycerophospholipid metabolism
Brite
KEGG Orthology (KO) [BR:btc00001]
 Metabolism
  Lipid metabolism
   00564 Glycerophospholipid metabolism
    CT43_CH4780
Enzymes [BR:btc01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.5  lysophospholipase
     CT43_CH4780
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(4734236..4735039)
Genome map
AA seq 267 aa AA seqDB search
MWNYEAEEAKAVIVIVHGAMEYHGRYEAVAEMWNHIGYHVVMGDLPSHGTTSRNRGHIDS
FDEYIEEVKLWVKEARKYRLPIFLFGHSMGGLIVIRMMQETKREDVEGIILSSPCLGVVT
GPSAPLQFASKILNVVAPKLQFATNLTVEMSTRNHEVRDAMENDSLFLRKVSVRWYSELI
KSIEIAHKKIDDFPDVPLLLMQACEDKLVDKTRVRTWFDNVKISDKAFKEWPNCYHELLN
EYERDEILSYIQSFTEMHVNNIVKTNK
NT seq 804 nt NT seq  +upstreamnt  +downstreamnt
atgtggaattatgaagcagaggaagcgaaagctgtcattgttattgtgcacggcgcaatg
gaatatcacggacgttacgaagccgttgcggaaatgtggaatcatatcggctaccacgtc
gtgatgggggaccttccgtcacatggaacgacttcaagaaatagaggacatattgattca
tttgatgaatacatagaggaagttaaattatgggtgaaagaagcaagaaagtataggtta
cctatttttttattcggtcatagtatgggtggtcttattgtcattcgtatgatgcaagaa
acgaagagagaagatgtagagggtattattttgagttcgccttgtttaggggtagtgact
ggaccctctgctccgcttcaatttgcttcaaaaatattaaatgttgtggctccaaaattg
caatttgcaacgaatcttacggtggaaatgtcaacacgtaaccatgaagtgagagatgca
atggagaatgattctttgttcttgcgcaaagtatcagtacgttggtatagtgaattgatt
aagtctatcgaaattgctcataaaaaaatagatgattttccagatgttccgctcttgcta
atgcaagcttgtgaggataaacttgtagataaaacacgtgtccgcacttggtttgataat
gttaaaataagtgataaggcttttaaagaatggccgaattgttatcacgagttattaaat
gagtatgagcgtgatgaaattttgagttatattcagtcatttactgaaatgcatgtcaat
aatatagtaaaaacaaacaaataa

DBGET integrated database retrieval system