KEGG   Bacillus thuringiensis serovar chinensis CT-43: CT43_CH4893Help
Entry
CT43_CH4893       CDS       T01838                                 

Gene name
glgB
Definition
glycogen branching protein
Orthology
K00700  
1,4-alpha-glucan branching enzyme [EC:2.4.1.18]
Organism
btc  Bacillus thuringiensis serovar chinensis CT-43
Pathway
Starch and sucrose metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:btc00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    CT43_CH4893 (glgB)
Enzymes [BR:btc01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.18  1,4-alpha-glucan branching enzyme
     CT43_CH4893 (glgB)
Exosome [BR:btc04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   CT43_CH4893 (glgB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(4845281..4847218)
Genome map
AA seq 645 aa AA seqDB search
MNVINCEEVKRDEFHTEKYYESYNIFGAHVVTEDEIQGVRFTVWAPHAKAMSVVGDFNEW
DYEQHKMLQVTEEGIWSLFIPHIEEGEIYKYAIETLAGDVILKADPYAVYAEVRPNTASV
VFDIKGYEWNDKNWNRKKKKKSIYKEAMTVYELHFGSWKKKEDGTLYSYREMVEELIPYV
VEHQFTHIEIMPLVEHPYDRSWGYQGTGYYAATSRFGTPHDLMHFVDECHKYGIGVILDW
VPGHFCKDAHGLYLFDGTPTYEYKDKDVQENPVWGTVNFDLGKREVRNFLISNALFWMRY
FHIDGFRVDAVANMLYWNKEGQEQSNEHAVSFLRELNEAVFAEDEDFLMTAEDSTAWPLV
TTPTYEGGLGFNYKWNMGWMNDVLKYMECAPEYRKHIHEKMTFSLLYAYSENFILPLSHD
EVVHGKKSLLNKMPGDYWDKFAQLRLLYGYFFTHPGKKLLFMGGEFGQFDEWKDLEDLDW
NLHDFEMHRYMHDYFNELIALYKRSKPLWQLDHSPEGFQWIDANNNEQSIFSFIRQGDKQ
EDALVVVCNFTKATYENYKVGVPDFEYYNEILNSDAEQYGGSGQVNKKRLKTILEPYHNQ
AAHVEITIPPFGVSILRPVKTRKGSKKQDGSKTKVRSNVTSRGKR
NT seq 1938 nt NT seq  +upstreamnt  +downstreamnt
ttgaatgtaataaattgtgaagaagtgaaacgagatgagtttcatacagaaaagtactat
gaaagttataacatctttggcgcgcatgttgtgacggaagatgagattcaaggggtacga
tttacagtgtgggctcctcatgcgaaagcaatgagtgttgttggggattttaatgagtgg
gattatgagcaacataagatgctacaagtgacagaagaaggcatttggtccttatttata
ccgcatattgaagaaggagaaatatataaatatgcgattgaaacgttggctggtgacgtc
attttaaaggcagatccgtatgctgtatatgcagaagtaagaccgaatacggcatctgta
gtttttgatataaaaggatatgaatggaatgataaaaactggaatcgtaagaaaaagaaa
aaatcgatttataaagaagcgatgacagtttatgaattacattttggttcttggaaaaag
aaagaagatggaacgctgtactcttacagggaaatggttgaagagctcatcccgtatgtg
gtggaacatcaatttacacatattgaaattatgccgcttgttgagcatccatatgatcgt
tcttggggataccaaggaacgggatattatgcagcgacgagtagatttggtacgccgcat
gatttaatgcattttgtcgacgaatgtcataaatatggaatcggtgtcattttagattgg
gtgccggggcatttttgtaaagatgctcacggtttatatttgtttgatggtacaccgacc
tatgaatataaagataaagatgtacaagaaaatccagtatggggaactgtcaattttgat
ttaggaaagagagaggtacgtaatttcttaatttcaaatgcgttattttggatgagatat
ttccatattgatggtttcagagttgatgcagttgcgaacatgttgtactggaataaagaa
ggacaagagcaaagtaatgagcatgctgtttcatttttaagagagttaaatgaagcagtg
tttgcagaggatgaagattttcttatgacggcagaagattcaacagcttggccacttgta
acaactccaacgtatgaaggtgggcttggattcaattacaaatggaacatgggctggatg
aatgacgtgctgaaatatatggagtgtgcgcctgaatataggaaacacattcatgagaaa
atgacgttttctttactatatgcgtactctgaaaacttcatattaccgctttctcatgat
gaagtcgttcatgggaaaaagtcgttattaaataaaatgccaggtgattactgggataag
tttgctcaacttcgtttattatatggatatttctttactcacccaggaaagaagttactt
ttcatgggaggagaattcggacagtttgatgagtggaaagaccttgaagatttagattgg
aatttacatgattttgaaatgcatcgttatatgcatgattactttaacgagctcatagca
ttgtataagcgctcaaaaccactttggcaacttgaccattcacctgaaggttttcagtgg
attgatgctaataataatgagcaaagtattttctcttttatccgccaaggggataaacaa
gaagatgcgttagttgtcgtatgtaattttacgaaagctacatatgaaaactataaagta
ggtgtaccagatttcgagtattataacgagattttaaacagtgatgctgagcaatatggc
ggttcggggcaagtgaataagaaacgtcttaagacgattctagaaccgtaccataatcaa
gcagcgcatgtagagattacaattccaccatttggcgtatccatattacgaccagtgaag
acgagaaaggggagcaaaaaacaagatggctcaaaaacaaaagtgcgtagcaatgttact
agcagggggaaaaggtag

DBGET integrated database retrieval system