KEGG   Bacillus thuringiensis serovar chinensis CT-43: CT43_CH5030Help
Entry
CT43_CH5030       CDS       T01838                                 

Definition
phosphoglycerate mutase
Orthology
K01834  
2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
btc  Bacillus thuringiensis serovar chinensis CT-43
Pathway
Glycolysis / Gluconeogenesis
Glycine, serine and threonine metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:btc00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    CT43_CH5030
   01230 Biosynthesis of amino acids
    CT43_CH5030
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    CT43_CH5030
  Energy metabolism
   00680 Methane metabolism
    CT43_CH5030
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    CT43_CH5030
Enzymes [BR:btc01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.11  phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
     CT43_CH5030
Exosome [BR:btc04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   CT43_CH5030
  Exosomal proteins of melanoma cells
   CT43_CH5030
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
4975675..4976229
Genome map
AA seq 184 aa AA seqDB search
MKKIILIRHCSATGQECDAELTTDGKDQANTLATFLLENTLQIDYIISSPFVRAIDSIRP
YALQANLSIQEDERLTERILSNVPMNDWMQKLESTFTNIDIAFSGGESTKQATDRAISLI
QDVLQLNHTTTLLVTHGNLLTLILKHFDHTIGFNEWRTLTNPDIYEITIDEQCIITRLWE
ALSK
NT seq 555 nt NT seq  +upstreamnt  +downstreamnt
atgaagaaaattattttaatacgacattgttcagcaactgggcaggaatgtgatgctgaa
ttaacgaccgatggaaaagaccaagcaaatacccttgctacattcctcttagaaaatact
ctacaaatcgattatattatttcaagcccatttgtccgagctatcgattccattcggccc
tatgcactccaagctaacttatctatccaagaagatgaacgattaactgaacgcatattg
agtaacgttccaatgaatgattggatgcaaaaactagaatccacttttacgaatatagat
attgccttttcaggcggagagtcaacaaaacaagcaacagaccgtgccatatcgcttatt
caagacgttttacaattaaaccatacgacaacactacttgttacacatggcaatttactt
acgctcattttaaagcattttgatcatacgattggctttaatgaatggagaactttaacg
aatcctgatatttacgaaattacaatcgacgaacaatgtatcataacacgcttatgggaa
gcattgtccaagtaa

DBGET integrated database retrieval system