KEGG   Bacillus thuringiensis serovar chinensis CT-43: CT43_CH5327Help
Entry
CT43_CH5327       CDS       T01838                                 

Gene name
murA1
Definition
UDP-N-acetylglucosamine 1-carboxyvinyltransferase
Orthology
K00790  
UDP-N-acetylglucosamine 1-carboxyvinyltransferase [EC:2.5.1.7]
Organism
btc  Bacillus thuringiensis serovar chinensis CT-43
Pathway
Amino sugar and nucleotide sugar metabolism
Peptidoglycan biosynthesis
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Amino sugar and nucleotide sugar metabolism [PATH:btc00520]
Metabolism; Glycan biosynthesis and metabolism; Peptidoglycan biosynthesis [PATH:btc00550]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(5273653..5274957)
Genome map
AA seq 434 aa AA seqDB search
MEKIIVRGGKRLNGTVRVEGAKNAVLPIIAAALLASDGKNVLSEVPVLSDVYTINEVLRH
LNAEVVFENNQVTIDSSKELNIEAPFEYVRKMRASVQVMGPLLARNGRARIALPGGCAIG
SRPIDQHLKGFEAMGAKVQVGNGFVEAYVEGELKGAKIYLDFPSVGATENIMSAATLAKG
TTILENAAKEPEIVDLANFLNAMGAKVRGAGTGTIRIEGVDKLYGANHSIIPDRIEAGTF
MVAAAITGGDILIENAVPEHLRSITAKMEEMGVKIIEENEGVRVIGPDKLKAVDIKTMPH
PGFPTDMQSQMMALLLQADGTSMITETVFENRFMHVEEFRRMNADIKIEGRSVIMNGPNS
LQGAEVGATDLRAAAALILAGLVSEGYTRVTELKHLDRGYVDFHKKLAALGATIERVNEK
VEEVKEQEVSDLHA
NT seq 1305 nt NT seq  +upstreamnt  +downstreamnt
ttggaaaagatcatcgtccgtggcggaaagcggttaaacggcacagtgcgtgttgagggc
gcaaaaaatgctgtattacctataatcgctgcagccctattagcgagtgatggaaagaat
gtactatctgaagtaccagttttgtctgatgtatacacaattaatgaggtattacgtcat
ttaaatgctgaagtcgtatttgaaaataatcaagtaacaatcgattcttctaaagaacta
aacattgaagcaccatttgaatatgtacgtaaaatgcgtgcatctgttcaagtaatggga
ccattattagcacgtaacggtcgtgctcgtattgcacttcctggtggatgtgcaatcggt
tcacgtccaattgaccaacatttaaaaggcttcgaagcaatgggagcaaaagtacaggtt
ggtaacggttttgttgaggcatatgttgagggagaactaaaaggagctaaaatctactta
gacttcccaagcgtaggcgcgacagaaaacattatgtctgcagctacattagcaaaaggg
acaacaattcttgaaaacgcagcgaaagaaccagaaatcgttgacttagctaacttctta
aatgcgatgggagcgaaagtacgcggagctggaactggaacgattcgtatcgaaggcgtt
gataaattatatggtgcaaaccactctattattcctgaccgtattgaagcgggaacattc
atggttgcagcagcaattactggtggagacatcttaattgaaaatgctgtacctgaacat
ttacgctcaattacagcgaaaatggaagaaatgggtgttaaaattattgaggaaaacgaa
ggtgtacgtgttatcggcccagataagttaaaagcggttgatattaaaactatgcctcac
ccaggtttcccaacagacatgcaatcacaaatgatggcattattactacaagctgatgga
acaagcatgattacagaaacggtatttgaaaaccgctttatgcacgttgaagaattccgt
cgtatgaatgctgatattaaaattgaaggtcgttctgttattatgaacggtccaaacagc
ttacaaggtgctgaagtaggcgcaactgatttacgtgctgcagctgcattaatcttagct
ggtttagtatcagaaggttatactcgtgtaactgagttaaaacatcttgaccgtggttat
gtagatttccataagaaattagctgcattaggtgcaactattgaacgtgtaaacgaaaaa
gtagaagaagtgaaagaacaagaagtttctgatcttcacgcttaa

DBGET integrated database retrieval system