KEGG   Burkholderia thailandensis MSMB121: BTI_1869Help
Entry
BTI_1869          CDS       T02644                                 

Gene name
xylA
Definition
xylose isomerase (EC:5.3.1.5)
Orthology
K01805  
xylose isomerase [EC:5.3.1.5]
Organism
btd  Burkholderia thailandensis MSMB121
Pathway
Pentose and glucuronate interconversions
Fructose and mannose metabolism
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Pentose and glucuronate interconversions [PATH:btd00040]
Metabolism; Carbohydrate metabolism; Fructose and mannose metabolism [PATH:btd00051]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1:2037497..2038819
Genome map
AA seq 440 aa AA seqDB search
MSYFEHIPPIRYEGPHSDNPLAYRHYDRTKRVLGKTLEEHLRIAVCYWHTFVWPGHDMFG
QEAFRRPWQQPGEPLERARQKADAAFEFFTKLGAPFYTFHDTDVAPEGANLHEYVENFTR
MVDYLGERQQASGVRLLWGTANLFSHPRFAAGAATNPNPDAFAWAATQVCHALDATRRLG
GENYVLWGGREGYETLLNTDLAREREQLARFLSMVVEHKHRTGFTGALLIEPKPQEPTKH
QYDHDVATVHGFLTQYGLQNEIRVNIEANHATLAGHSFHHEIANAFALGVFGSVDANRGD
PQNGWDTDQFPNSVEELTLAFYEILRHGGFTTGGMNFDAKVRRQSVDPEDLFHGHVGAID
VLALALERAAVLVENDRLDALRRQRYAQWDSAFGRKILAGGYSLQSLAADALARGVNPRH
ASGAQERLENIVNQAIYALR
NT seq 1323 nt NT seq  +upstreamnt  +downstreamnt
atgtcgtatttcgaacacattcccccgattcgctacgaaggcccgcactcggacaatccg
cttgcgtaccggcattacgaccgcacgaagcgggtgctcggcaagacgctcgaggagcac
ctgcggatcgccgtctgctactggcacacgttcgtgtggccgggccacgacatgttcggc
caggaggcgttccggcggccgtggcagcagccgggtgagccgctcgagcgcgcgcggcag
aaggccgatgcggcgttcgaattcttcacgaagctcggcgcgccgttctacacgttccac
gataccgacgtcgcgccggaaggggcgaacctgcacgagtacgtcgagaacttcacgcgg
atggtcgactatctcggcgagcgccagcaggcgagcggcgtgcggctgctgtggggcacc
gcgaacctgttctcgcatccgcgcttcgcggccggcgcggcgacgaacccgaaccccgac
gcgttcgcgtgggcggcgacccaggtgtgccacgcgctcgacgcgacgcgccggctcggc
ggcgagaactacgtgctgtggggcggccgcgaagggtacgagacgctgctcaacaccgat
ctcgcgcgcgagcgcgagcaattggcgcggttcctgtcgatggtcgtcgagcacaagcac
cgcaccggcttcaccggcgcgctgctgatcgagccgaagccgcaggagccgaccaagcac
cagtacgaccacgacgtcgcgacggtgcacggcttcctcacgcaatacggattgcagaac
gaaatccgcgtgaacatcgaggcgaaccacgcgacgctcgccggccattcgttccatcac
gagatcgcgaacgcgttcgcgctcggcgtgttcggcagcgtcgacgcgaaccgcggcgat
ccgcagaacggctgggacaccgaccagttcccgaacagcgtcgaggagctgacgctcgcg
ttctacgagatcctgcgccacggcggcttcacgacgggcggcatgaacttcgacgcgaag
gtgcggcgccagagcgtcgatccggaagacctgttccacggccatgtcggcgcgatcgac
gtgctcgcgctcgcgctcgagcgcgcggccgtgctggtggagaacgaccggctcgatgcg
ctgcgccggcagcgctacgcgcagtgggattcggcgttcggccgcaagatcctcgcgggc
ggctactcgctgcagtcgctcgccgccgacgcgctcgcgcgcggcgtgaacccgcggcac
gcgagcggcgcgcaggagcggctcgagaacatcgtgaatcaggcgatctacgcgctgcgc
tga

DBGET integrated database retrieval system