KEGG   Burkholderia thailandensis MSMB121: BTI_2438Help
Entry
BTI_2438          CDS       T02644                                 

Definition
alpha/beta hydrolase family protein
Orthology
K03928  
carboxylesterase [EC:3.1.1.1]
Organism
btd  Burkholderia thailandensis MSMB121
Brite
Enzymes [BR:btd01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.1  carboxylesterase
     BTI_2438
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1:complement(2685307..2685768)
Genome map
AA seq 153 aa AA seqDB search
MDSSPVLEGAEPFLFDGNATGILISHGYTGSTQSVRYVGEQLHRRVGYTVLGPRLAGHGI
SPEAMDRTSAIDWVESIDQALDALRQKCERIVMMGLSMSATYDSGSRASGSRVARSTATS
IAVLDAAACASAPQSARDDEPSGFGRLSHVSIG
NT seq 462 nt NT seq  +upstreamnt  +downstreamnt
atggattcctctcccgtcctcgagggcgccgagccgttcctgttcgacggcaacgccacc
ggcatcctgatttcccacggctataccggctcgacgcagagcgtccggtacgtcggcgag
cagcttcatcgccgcgtcggctacacggtgctcggcccgcggctcgcggggcacggaatc
agcccggaagcgatggaccgcacgtcggcgatagactgggtggaaagcatcgaccaggcg
ctcgacgcgttgcgacagaaatgcgagcgcatcgtgatgatgggcttgtcgatgagtgca
acgtacgattcgggcagccgcgcatcgggctcgcgagtcgcgagatcgacggcgacgagt
atcgcggtgctcgacgcggcggcctgcgcgagcgccccgcaatcggcgcgcgacgacgag
ccttcgggcttcggccgcttgagccacgtatcgatcgggtga

DBGET integrated database retrieval system