KEGG   Burkholderia thailandensis MSMB121: BTI_2878Help
Entry
BTI_2878          CDS       T02644                                 

Definition
class II Aldolase and Adducin N-terminal domain protein
Orthology
K01628  
L-fuculose-phosphate aldolase [EC:4.1.2.17]
Organism
btd  Burkholderia thailandensis MSMB121
Pathway
Fructose and mannose metabolism
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:btd00001]
 Metabolism
  Carbohydrate metabolism
   00051 Fructose and mannose metabolism
    BTI_2878
Enzymes [BR:btd01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.17  L-fuculose-phosphate aldolase
     BTI_2878
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1:3169713..3170498
Genome map
AA seq 261 aa AA seqDB search
MVDTLKMGKAELVALAQRRLDNEIKDSGWTAREKLALTCRILFDDGHDCGLAGQITCRAD
TPHTYYTQRLGLGFDEITESNLLQVDQDLEVIGGEGIPNPANRFHTWIYRARPDVNCIIH
THPAHVAALSMLETPLVVSHMDTCPLYDDCAFLKDWPGVPVGNEEGEIISNALGDKRAIL
LSHHGQLVVGKTIEEACMLAILIERAARLQLLAMAAAGAIEPIPPALATDAHDWISTPKR
DAVTFAYYARRALRHHPDCLG
NT seq 786 nt NT seq  +upstreamnt  +downstreamnt
atggtcgacacattgaagatgggcaaggccgagctcgtcgcgctcgcgcagcggcggctc
gacaacgaaatcaaggatagcgggtggaccgcgcgcgagaagcttgcgctcacgtgccgg
atcctgttcgacgacgggcacgactgcggcctcgccggacagatcacgtgccgtgcggat
acgccgcacacgtactacacgcagcgcctcgggctcggtttcgacgagatcaccgaatcg
aatctgctgcaggtcgatcaggatctcgaagtgatcggcggcgaaggcattccgaatccc
gccaaccgctttcacacgtggatctatcgcgcgcgccccgacgtcaactgcatcatccac
acgcatccggcgcacgtcgccgcgctgtcgatgctagagacgccgctcgtcgtgtcgcac
atggacacctgtccgctctacgacgattgcgcgttcctgaaggattggccaggcgtgccc
gtcggcaacgaggaaggcgagatcatctcgaacgcgcttggcgacaagcgcgcgatcctg
ctgtcgcatcacggccagctcgtcgtcggcaaaacgatcgaggaggcgtgcatgctcgcg
atcctgatcgagcgcgcagcgcggctgcaactgctggcgatggcggcggccggcgcgatc
gagccgatcccgcccgcgctcgcgaccgacgcacacgactggatctcgacgccgaagcgc
gacgccgtgacgttcgcgtactacgcgcggcgcgcgctgcgccatcaccccgactgcctc
ggctga

DBGET integrated database retrieval system