KEGG   Burkholderia thailandensis MSMB121: BTI_3372Help
Entry
BTI_3372          CDS       T02644                                 

Definition
alkaline phosphatase family protein
Orthology
K01077  
alkaline phosphatase [EC:3.1.3.1]
Organism
btd  Burkholderia thailandensis MSMB121
Pathway
Aminobenzoate degradation
Folate biosynthesis
Metabolic pathways
Microbial metabolism in diverse environments
Two-component system
Module
Tetrahydrofolate biosynthesis, GTP => THF
Brite
KEGG Orthology (KO) [BR:btd00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    BTI_3372
  Xenobiotics biodegradation and metabolism
   00627 Aminobenzoate degradation
    BTI_3372
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    BTI_3372
Enzymes [BR:btd01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.1  alkaline phosphatase
     BTI_3372
Exosome [BR:btd04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   BTI_3372
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1:complement(3726659..3728089)
Genome map
AA seq 476 aa AA seqDB search
MRLAALLCASVFAAAGCGSDEPKTPGASDDGAQASAARNVIFFLGDGMGMTTLTAARIYA
VGEDGALTLDTLPETAFVKTYSNDAQVTDSAPSMSAYMTGVKTNNEVISMTPDTKAIEPT
ASLTGNCGANNGKPVPTLLEIAKAKGLATGVVTTTRVTHATPAATYAHVCHRDAENDIAA
QLVPGGAGYNAALGNGVDVVLGGGAQFFVPKDAGGKRADGRNLVNELKAKGYAIAQNRDE
LFAADAAKSGKLAGLFATSHMSYDLDRGATKEPSLADMATRALDVLQKNPNGYFLMVEGG
RIDHALHDTNAKRALQDTVAFDNAIKATLDKVRQTDPDLKNTLVVVTADHDHTLVLNGYA
ARTGKTEAGKPGVLGVLRNYQTGAVAKDADGAPYTIIGFGNGENRVQGSRAGTSFTDAVT
GADDYRQEAVVRMAKGGETHGGTDVFLGAIGRGAEGFHGVIENNKVFELVRSAAQL
NT seq 1431 nt NT seq  +upstreamnt  +downstreamnt
gtgagattggccgcgctcctttgcgcgagcgtcttcgcggcggcgggctgcggcagcgac
gagccgaagacgccgggcgcatcggacgacggcgcgcaagcgagtgccgcgcgcaacgtc
atcttctttctgggcgacgggatggggatgacgacgctgacggccgcgcgcatctatgcg
gtcggcgaggacggcgcgctcacgctcgacacgctgcccgagaccgcgttcgtgaagacc
tattcgaacgatgcgcaggtgacggacagcgcgccgtcgatgtccgcgtacatgacgggc
gtgaagacgaataacgaagtgatctcgatgacgcccgacacgaaggcgatcgagccgacc
gcgagcctcaccggcaactgcggcgcgaacaacggcaaaccggtgccgacgctgctcgag
atcgcgaaggcgaaggggctcgccacgggcgtcgtcacgacgacccgcgtcacgcacgcg
acgcctgcggcgacctacgcgcacgtgtgccatcgcgacgccgagaacgacatcgccgcg
cagctcgtgccgggcggcgcgggctacaacgcggcgctcggcaacggcgtcgacgtcgtg
ctgggcggcggcgcgcagttcttcgtgccgaaggatgcgggcggcaagcgcgcggacggc
cgcaatctcgtgaacgagctgaaggcgaagggctacgcgatcgcgcagaaccgcgacgag
ctcttcgctgccgatgcggcgaagagcggcaagctcgcgggtctcttcgcaacgagccac
atgagctacgacctcgaccgcggcgcgacgaaggagccgagcctcgccgacatggcgacg
cgcgcgctcgacgtgctgcagaagaacccgaacggctatttcctgatggtcgaaggcggg
cgcatcgatcacgcgctgcacgacacgaatgcgaagcgcgcgctgcaggacacggtggcg
ttcgacaacgcgatcaaggcgacgctcgacaaggttcgccagaccgatccggatctgaag
aacacgctcgtcgtcgtgacggccgaccacgaccacacgctggtgctgaacggctacgcg
gcgcgcacgggcaagacggaagcgggcaagccgggcgtgctcggcgtgctgcgcaactat
cagacgggcgcggtcgcgaaggacgcggacggcgcgccgtacacgatcatcggcttcggc
aacggcgagaaccgcgtgcagggcagccgcgcgggcacgagcttcaccgacgcggtgacg
ggcgcggacgactatcgccaggaagcggtcgtgcggatggcgaagggcggcgagacgcac
ggcggcaccgacgtgttcctcggcgcgatcggccgcggcgcggaaggctttcacggcgtg
atcgagaacaacaaggtgttcgagctcgtgcgcagcgcggcgcagctctga

DBGET integrated database retrieval system