KEGG   Burkholderia thailandensis MSMB121: BTI_4062Help
Entry
BTI_4062          CDS       T02644                                 

Definition
(GenBank) glycosyl hydrolases 8 family protein
  KO
K20542  
endoglucanase [EC:3.2.1.4]
Organism
btd  Burkholderia thailandensis MSMB121
Brite
Enzymes [BR:btd01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.4  cellulase
     BTI_4062
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
Position
2:complement(548172..549533)
Genome map
AA seq 453 aa AA seqDB search
MRQARAGAAQRRSSRGRRMLGRVAACVVAAGVAVAALAAMSGSVAWAAERARGDDERLDA
GLRDAAGAIAPSASAASMSASPTAEPARASAGAAACTPSWPRWARFKRDFVSADGRVIDV
GSADERTVSEGQAYGLFFALVANDRPAFDALLRWTEDHLAQGDLAAHLPAWLWGRAADGA
LRVLDANAASDADLWIAYALLEAGRLWRERSYTARGALLAKRVLDDETATLPGLGLVLLP
GPTGFRPARDAWRLNPSYSPPQAIRGLGAHLPGDARWARLAASVGRVLIDSAPRGFAPDW
ALYRPDHGFEPDADTHAASAYNAIRVYLWAGMLDADDALARPLAAHFAPFAAHVAAHGAP
PETVDATTGAAGPHDGNAGFSAAAVPFLDARGERALADTQVARIARLERETASGYYANVL
TLFGLGWRDGRYRFAADGTLRVRWSEPCSMPAR
NT seq 1362 nt NT seq  +upstreamnt  +downstreamnt
atgcgacaggcgcgggcaggcgcggcgcagcggcgatcgtcgcgcgggcggcggatgctt
gggcgcgtggctgcgtgcgtcgtggcggcgggcgtcgcggtggcggcgctcgcggcgatg
tcgggaagcgtcgcgtgggcggcggagcgggcacggggcgatgacgagcggctcgacgct
ggattgcgcgacgcggcgggtgcgatcgcgccgtcagcatcggcggcatcgatgtcggca
tcgccgacggcggagcctgcccgcgcgtccgcgggcgccgccgcctgcacgccgtcctgg
ccgcgctgggcgcgcttcaagcgcgatttcgtgtcggccgacggccgcgtgatcgacgtc
ggctcggccgacgagcggaccgtgtccgaggggcaggcgtatggcctcttcttcgcgctc
gtcgcgaacgaccggccggcgttcgacgcgctgctccgctggaccgaggaccacctcgcg
cagggcgacctggccgcgcatctgcccgcgtggctgtggggccgagcggcggacggcgcg
ttgcgcgtgctcgacgcgaacgccgcatccgacgccgatctgtggatcgcgtacgcgctg
ctcgaagccgggcgcctgtggcgcgagcgcagctacaccgcgcgcggcgcgctgctcgcg
aagcgcgtgctcgacgacgagaccgcgacgctgccggggctcggcctcgtgctgctgccc
ggcccgacgggctttcggccggcgcgcgacgcatggcggctgaacccgagctattcgccg
ccgcaggcgattcgcgggctcggcgcgcatctgcccggcgacgcgcgctgggcgcggctc
gcggcgagcgtcggccgcgtgctgatcgacagcgcgccgcgcggcttcgcgccggactgg
gcgctgtaccgcccggaccacggcttcgagccggacgccgatacgcacgcggcgagcgcg
tacaacgcgattcgcgtctatctgtgggcgggcatgctcgacgcggacgacgcgctcgcg
cggccgctcgccgcgcatttcgcgccgttcgccgcgcacgtcgccgcgcacggcgcgccg
ccggagacggtcgatgcgacgacgggcgcagccggcccgcacgacggcaacgccgggttt
tccgcggcggccgtgccgtttctcgatgcgcgcggcgagcgcgcgctcgccgacacgcag
gtcgcgcgcatcgcgcggctcgaacgcgagacggcgagcggctactacgcgaacgtgctg
acgctgttcgggctcggctggcgcgacgggcgttaccggttcgcggcggacggcacgctg
cgggtccgatggagcgagccgtgctcgatgcctgctcgttga

DBGET integrated database retrieval system