KEGG   Burkholderia thailandensis MSMB121: BTI_4933Help
Entry
BTI_4933          CDS       T02644                                 

Definition
pfkB carbohydrate kinase family protein
Orthology
K00852  
ribokinase [EC:2.7.1.15]
Organism
btd  Burkholderia thailandensis MSMB121
Pathway
Pentose phosphate pathway
Brite
KEGG Orthology (KO) [BR:btd00001]
 Metabolism
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    BTI_4933
Enzymes [BR:btd01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.15  ribokinase
     BTI_4933
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2:complement(1666035..1667090)
Genome map
AA seq 351 aa AA seqDB search
MASLARTCASRGAAGKADPRGLRATLPRVAQQAGVLVVGSLNIDLLLYSDASPSEGDSLP
VRAIALPGGHAGNCASALAALGLAVSIVAALGDDADGDRLLTDLDARGIDTRFVRRVAHA
HTGRAIIPVLGPERRNYMLLDRGANESLAAADVRAALSGVARCDALMLFDPSADALAQTF
ALARAHHPATALCWTPSGMYSRDPVALPLLPQCDVVFANAREFAHLREQDERVLDALDWV
DVVVTLGERGALSRHRGVETHAPAHPCEVVDPTGAGDAFASAYLLARLAGLDAADRLRLG
NAGGACAVGTRGARDGLPTLDALLDAALDSPQGRSAPPRAEEPAHAHAAKR
NT seq 1056 nt NT seq  +upstreamnt  +downstreamnt
gtggctagcctcgcccgcacctgcgcttcgcgcggcgccgccgggaaagccgatccgcgc
ggcctgcgggcgacgctgccgcgcgtcgcgcaacaggcgggcgtgctcgtcgtcggctcg
ctgaacatcgatctgctgctgtacagcgatgcgtcgccgagcgaaggcgactcgctgccc
gtgcgcgcgatcgcgctgccgggcggccacgcgggcaactgcgcgtccgcgctggcggcg
ctcggcctggccgtgtcgatcgtcgcggcgctcggcgacgacgccgacggcgatcggctg
ctcaccgacctcgacgcgcgcggcatcgacacgcgcttcgtgcggcgcgtcgcgcacgcg
cacaccggccgcgcgatcatccccgtgctcggccccgagcgccgcaactacatgctgctc
gatcgcggcgcgaacgagtcgctcgccgccgccgacgtgcgcgccgcgctgtcgggcgtc
gcgcgctgcgacgcgctcatgctgttcgatccgagcgccgatgcgctcgcgcagacgttc
gcgctcgcgcgcgcgcatcacccggccaccgcgctgtgctggacgccgtccggcatgtat
tcgcgcgatccggtcgcgctgccgctgttgccgcaatgcgacgtcgtgttcgccaacgcg
cgcgagttcgcgcatctgcgcgagcaggacgagcgcgtgctcgacgcgctggactgggtc
gacgtcgtcgtcacgctcggcgagcgcggcgcgctgtcccgccatcgcggcgtcgagacg
cacgcgccggcgcatccgtgcgaagtcgtcgatccgaccggcgcgggcgacgcgttcgca
tcggcctacctgctcgcgcggctcgccggcctcgatgcggccgatcgcctgcggctcggc
aacgcgggcggcgcatgcgcggtcggcacacgcggcgcacgcgacggcctgccgacgctc
gacgcgctgctcgacgcggcgctggacagcccgcaaggccggtccgcgccgccgcgcgcc
gaggagcccgcccatgcgcatgcggcgaagcgctga

DBGET integrated database retrieval system