KEGG   Burkholderia thailandensis MSMB121: BTI_4942Help
Entry
BTI_4942          CDS       T02644                                 

Definition
fatty acid desaturase family protein
Orthology
K00507  
stearoyl-CoA desaturase (delta-9 desaturase) [EC:1.14.19.1]
Organism
btd  Burkholderia thailandensis MSMB121
Pathway
Biosynthesis of unsaturated fatty acids
Fatty acid metabolism
Class
Metabolism; Overview; Fatty acid metabolism [PATH:btd01212]
Metabolism; Lipid metabolism; Biosynthesis of unsaturated fatty acids [PATH:btd01040]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2:complement(1675052..1676002)
Genome map
AA seq 316 aa AA seqDB search
MKDASAGRASGHLSRASSARHLGVAAIPAAGTAAAIALWARFGLAPRAQDIAMLVVFYVL
NILGMELALHRYFAHRTFKAKPPVKIALAILGSLAYMGPLMWWVAIHRLHHANADQPGDP
HTPQLGGRDFVGRAKGILHGHVGWLFDPPSARPNGWNQYANDMYRDPALLRIHLAYDYWL
LLGLLLPGAIGWLLDPSWQGALLGLLWGGTVRIFLATNAIWAVNSIGHALGGRRPFPGRD
QSRNIRWLAILTLGAGWHNNHHAFPQYASTRLTRWQIDVTGMLIALLERLGLVWDVQHPD
RDAIRERLANARRDDA
NT seq 951 nt NT seq  +upstreamnt  +downstreamnt
atgaaggacgcgtccgccggtcgcgcgtccgggcatctgtcccgcgcgtcgtccgcgcgc
catctcggcgtcgcggcgatacccgccgccggcacggccgccgcgatcgcgctctgggct
cgattcggcctcgcgccgcgcgcgcaggacatcgcgatgctcgtggtcttctacgtgctc
aacatcctcggcatggagctcgcgctgcatcgctacttcgcgcatcgcacgttcaaggcg
aagccgcccgtgaagatcgcgctcgcgatcctcggttcgctcgcgtacatggggccgctg
atgtggtgggtcgcgattcaccggctgcatcacgcgaacgccgaccagccaggcgacccg
cacacgccgcaactcggcgggcgcgacttcgtcggccgcgcgaagggcatcctgcacggc
cacgtcggctggctgttcgatccgccgtccgcgcgcccgaatggctggaaccagtatgcg
aacgacatgtaccgcgatccggcgctgctgcgcatccatctcgcgtatgactactggctg
ctgctcggcctgctgctgccgggcgcgatcggctggctgctcgatccgtcgtggcaaggc
gcgctgctcggcctgctgtggggcgggaccgtgcggatctttctcgcgacgaacgcgatc
tgggcggtcaattcgatcggccacgcgctcggcggccgccggccgtttcccggccgcgac
cagagccgcaacataaggtggctcgcgatcctgacgctcggcgccggctggcacaacaac
catcacgcgtttccgcagtatgcgagcacgcgcttgacccgctggcagatcgacgtgacc
ggcatgctgatcgcgctgctcgaacggctcggactcgtgtgggacgtgcagcaccccgat
cgggacgcgattcgcgagcggctcgcgaacgcgcggcgcgacgatgcgtga

DBGET integrated database retrieval system