KEGG   Burkholderia thailandensis MSMB121: BTI_5185Help
Entry
BTI_5185          CDS       T02644                                 

Definition
acetaldehyde dehydrogenase (EC:1.2.1.10)
Orthology
K04073  
acetaldehyde dehydrogenase [EC:1.2.1.10]
Organism
btd  Burkholderia thailandensis MSMB121
Pathway
Phenylalanine metabolism
Benzoate degradation
Pyruvate metabolism
Dioxin degradation
Xylene degradation
Butanoate metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:btd00001]
 Metabolism
  Overview
   01220 Degradation of aromatic compounds
    BTI_5185
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    BTI_5185
   00650 Butanoate metabolism
    BTI_5185
  Amino acid metabolism
   00360 Phenylalanine metabolism
    BTI_5185
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    BTI_5185
   00622 Xylene degradation
    BTI_5185
   00621 Dioxin degradation
    BTI_5185
Enzymes [BR:btd01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.10  acetaldehyde dehydrogenase (acetylating)
     BTI_5185
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2:1950804..1951697
Genome map
AA seq 297 aa AA seqDB search
MKNKSSRTRVAILGSGSIGLDLMFKVKASEQFDLKFVVGRHANSEGLKLARSCNVETSSD
GLDFLKAHEDAYDLVFDATSAAAHKVNNRFFSDAGKFVIDLTPAKLGRLCVPCINLDDIG
AEQNVNLITCGGQASLPLAYALKQAVDEIEYLEVVSAIASRSAGIATRENIDEYMTTTEY
ALAKFSGAKKTKAILNINPAEPGVRMQTTLYAYARYRDFDRVRACVADMVEKVREYVPGY
RLVVEPIESQGRITISLTVRGRGDYLPEYAGNLDIINCAALAVASHRHATARLGATQ
NT seq 894 nt NT seq  +upstreamnt  +downstreamnt
atgaagaacaagtcatcgcgcacgcgggtggcgatcctcgggtcgggcagcatcgggctc
gacctgatgttcaaagtcaaggcatccgaacaattcgatctgaaattcgtcgtcggacgc
catgcgaacagcgaggggctgaagctcgcacgtagctgcaacgtcgagacgtcgagcgac
ggcctcgacttcctgaaggcgcacgaggatgcgtatgacctcgtgttcgacgcgacgtcg
gccgcagcgcacaaggtcaacaaccgcttcttctccgacgcgggcaagttcgtgatcgat
ctgacgcctgcgaagctcggccgcctgtgcgtgccgtgcatcaatctggacgacatcggc
gccgagcagaacgtgaacctgatcacctgcggcgggcaggcgagcctgccgctcgcgtat
gcgctgaagcaggcggtcgacgagatcgaatacctggaggtggtgtcggcgatcgcgtcg
cgcagcgccggcatcgcgacgcgcgagaacatcgacgaatacatgacgacgaccgagtac
gcgctcgcgaagttcagcggtgcgaagaagacgaaggcgatcctcaacatcaatccggcc
gagcccggcgtgcggatgcagacgacgctctatgcgtacgcgcgctatcgcgatttcgac
cgcgtgcgcgcgtgcgtcgccgacatggtcgagaaggtccgcgaatacgtgcccggctac
cggctcgtcgtcgagccgatcgagagccagggaaggatcacgatcagcctcaccgtgcgc
gggcgcggagactatctgcccgagtacgcgggcaatctcgacatcatcaattgcgcggcg
ctcgcggtcgcctcgcatcggcacgcaaccgccagactaggagccacacaatga

DBGET integrated database retrieval system