KEGG   Burkholderia thailandensis MSMB121: BTI_542Help
Entry
BTI_542           CDS       T02644                                 

Definition
DSBA-like thioredoxin domain protein
Orthology
K03981  
thiol:disulfide interchange protein DsbC [EC:5.3.4.1]
Organism
btd  Burkholderia thailandensis MSMB121
Brite
Enzymes [BR:btd01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.4  Transposing S-S bonds
    5.3.4.1  protein disulfide-isomerase
     BTI_542
Secretion system [BR:btd02044]
 Type IV secretion system
  Conjugal transfer pilus assembly protein
   BTI_542
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1:588067..588795
Genome map
AA seq 242 aa AA seqDB search
MKKTIRIATLALAAATATLGCTAQADQATDKLKATLQSRLGADAPIKSVTKSPIEGLYEV
NLGSQIVYSDASGNYVLLGELVNTKTHKNLTAERLAEINKIDFASLPLSNAIKVVKGNGA
RRIAVFSDPNCPYCKKLETTLQSVDNVTVYTFLYPVLSSDSTAKSKSIWCASDRVKSWQA
WMLEHRAPAAAANCDTTALDKNLALGRGMNVTGTPTVFLADGTRLPGAVSADELNQALAS
VK
NT seq 729 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaaaacgattcgtatcgccacgctggcgctcgccgccgcgacggcgacgctcggc
tgcaccgcgcaggccgaccaggccaccgacaagctgaaggccacgctgcaatcgcgcctc
ggcgccgacgccccgatcaagagcgtgacgaagtcgccgatcgagggtttgtacgaggtc
aatctcggctcgcagatcgtctatagcgacgcgtcgggcaattacgtgctgctcggcgag
ctcgtcaacacgaagacgcacaagaacctgacggccgagcgtctcgccgagatcaacaag
atcgatttcgcgagcctgccgctttcgaacgcgatcaaggtcgtgaagggcaacggcgcg
cgcaggatcgcggtgttctccgatccgaactgcccgtactgcaagaagctcgagacgacg
ctgcaatcggtcgacaacgtgaccgtctacacgttcctgtatccggtgctgtcgtccgat
tcgacggcgaagtcgaagtcgatctggtgcgcgagcgaccgcgtgaagagctggcaggca
tggatgctcgagcatcgcgcgcccgcggccgcggcgaactgcgacacgaccgcgctcgac
aagaatctcgcgctcggccgcggcatgaacgtgacgggcacgccgaccgtgttcctcgcc
gacggtacgcgcctgccgggcgccgtgtccgccgacgaactgaatcaggcgctcgccagc
gtcaagtga

DBGET integrated database retrieval system