KEGG   Burkholderia thailandensis MSMB121: BTI_55Help
Entry
BTI_55            CDS       T02644                                 

Definition
catalase family protein
Orthology
K03781  
catalase [EC:1.11.1.6]
Organism
btd  Burkholderia thailandensis MSMB121
Pathway
Tryptophan metabolism
Glyoxylate and dicarboxylate metabolism
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:btd00001]
 Metabolism
  Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    BTI_55
  Amino acid metabolism
   00380 Tryptophan metabolism
    BTI_55
Enzymes [BR:btd01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.6  catalase
     BTI_55
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1:complement(72142..73224)
Genome map
AA seq 360 aa AA seqDB search
MEHPSTPPAGPARGLWRWALIGGAVAALAASFGYVGGWLAPHRLTPQRLVDALQRNSGLH
PGYRRNHAKGVCVTGYFEGNGAASAHSTAPFFAAVRTPVVGRFALPGGNPYAPDNSVPIR
SLALRLTAPDGEQWRMGMNSMPVFPVATPRAFYEQTVAGRPDPKTGKPDPAKLKAFFDAH
PETAAFRAWAKTAKPSASYVTETYYSLNAFYLVDAAGRRQAVRWRVAPEQTAEAGDVAKA
GDPNVLQEDLTRRIGSGPQRWHLLLTLAEPGDPVDDATRTWPANRTTIDAGTLVLDRVEA
QDSGPCRDVNYDPTILPDGIRASGDPLLAARSAAYADSYLRRTSEEAGIPGAAHPLSEKR
NT seq 1083 nt NT seq  +upstreamnt  +downstreamnt
atggaacatccttcaacaccgccggccgggccggcgcgcggcctctggcggtgggcgctg
atcggcggcgcggtggcggcactcgcggcgtcgttcggctacgtcggcggctggctcgcg
ccgcaccggctgacgccgcagcgactcgtcgacgcgttgcagcgcaatagcggcctgcat
ccgggctaccggcgcaatcacgcgaaaggcgtgtgcgtgacgggctatttcgaaggcaac
ggcgcggcgagcgcgcattcgaccgcgccctttttcgcggcggtgcgcacgccggtggtc
gggcgcttcgcgctgccgggcggcaatccgtacgcgccggacaacagcgtgccgatccgc
agcctcgcgctgcgcctgaccgcgcccgacggcgagcaatggcgcatgggaatgaacagc
atgccggtgtttccggtcgcgacgccgcgtgcgttctacgaacagacggtggcgggccgg
cccgatccgaagacgggcaagcccgacccggcgaagctgaaggcgttcttcgacgcgcat
ccggagacggccgcgttccgcgcgtgggcgaagacggcgaagccgagcgcgagctacgtc
accgagacgtattacagcctgaacgcgttctatctcgtcgatgcggcgggaaggcggcag
gcggtgcggtggcgcgtcgcgccggaacagacggccgaggcgggcgatgtcgcgaaggcc
ggcgatccgaacgtgctgcaggaggacctgacgcggcgcatcggctccgggccgcagcgc
tggcatttgctgctcacgctggcggagccgggcgaccccgttgacgacgcgacgcgcaca
tggcccgcgaatcgcacgacgatcgatgcgggcacgctcgtgctcgatcgcgtggaggcg
caggacagcggcccgtgccgcgacgtcaactacgacccgacgatcctgcccgacggcatc
cgagcgtcgggcgacccgctgctcgccgcgcgctcggccgcgtatgcggattcgtatctg
cgccgcacgagcgaagaggccgggatacccggcgctgcgcatccgctttcggagaaacga
tga

DBGET integrated database retrieval system