KEGG   Burkholderia thailandensis MSMB121: BTI_65Help
Entry
BTI_65            CDS       T02644                                 

Definition
(GenBank) acetyl-CoA C-acetyltransferase family protein
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
btd  Burkholderia thailandensis MSMB121
Pathway
btd00071  Fatty acid degradation
btd00072  Synthesis and degradation of ketone bodies
btd00280  Valine, leucine and isoleucine degradation
btd00310  Lysine degradation
btd00362  Benzoate degradation
btd00380  Tryptophan metabolism
btd00620  Pyruvate metabolism
btd00630  Glyoxylate and dicarboxylate metabolism
btd00640  Propanoate metabolism
btd00650  Butanoate metabolism
btd00900  Terpenoid backbone biosynthesis
btd01100  Metabolic pathways
btd01110  Biosynthesis of secondary metabolites
btd01120  Microbial metabolism in diverse environments
btd01130  Biosynthesis of antibiotics
btd01200  Carbon metabolism
btd01212  Fatty acid metabolism
btd02020  Two-component system
Brite
KEGG Orthology (KO) [BR:btd00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    BTI_65
   00630 Glyoxylate and dicarboxylate metabolism
    BTI_65
   00640 Propanoate metabolism
    BTI_65
   00650 Butanoate metabolism
    BTI_65
  Lipid metabolism
   00071 Fatty acid degradation
    BTI_65
   00072 Synthesis and degradation of ketone bodies
    BTI_65
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    BTI_65
   00310 Lysine degradation
    BTI_65
   00380 Tryptophan metabolism
    BTI_65
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    BTI_65
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    BTI_65
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    BTI_65
Enzymes [BR:btd01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     BTI_65
Exosome [BR:btd04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   BTI_65
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt ACP_syn_III_C
Motif
Other DBs
NCBI-ProteinID: AGK49240
Position
1:complement(80999..82204)
Genome map
AA seq 401 aa AA seqDB search
MEAYIFDAVRTPRGKGKKDGSLHGVTPLALAATALRAIRDRNGLDTSAVDDVVLGCVEPV
GEQGACIGRIAVLAAGYAQTTAGVQVNRFCASGLEACNMAAAQVMSGQSDMAIGGGVESM
SRVPMGASGGAWPVDPAIAIPSYFVPQGVSADTIATKWGYSRADVDAYAAESHRRAYAAT
QAGWFARSIVPVRDVNGLTILDRDETIRPQTTPETLATLKPSFAELGEMYGFDAVIRQRY
PELERIEHVHHAGNSSGIVDGASAVLIGSLEAGKRAGLAPRARVRSFASIGSEPSIMLTG
PAYAAEKALKRAGMRAADIDLYELNEAFASVVLRFMDAMAIAHDRINVNGGAIAMGHPLG
ATGAMILGTLLDELERRGAATGLATLCVGAGMGTATIIERI
NT seq 1206 nt NT seq  +upstreamnt  +downstreamnt
atggaagcctacattttcgacgccgtgcgcacgccgcgcggcaaaggcaagaaggacggc
agcctgcacggcgtcacgccgctcgcgctcgccgcaaccgcgctgcgcgcgattcgcgat
cgcaacggtctcgacacgagcgccgtcgacgacgtcgtgctcggctgcgtcgagcccgtc
ggcgagcagggcgcgtgcatcggccgcatcgcggtgctcgcggcgggttacgcgcagacg
acggccggcgtgcaggtcaaccgcttctgcgcgtcgggcctcgaagcgtgcaacatggcg
gccgcgcaggtgatgtccggccagtcggacatggcgatcggcggcggcgtcgagagcatg
tcgcgcgtgccgatgggcgcgagcggcggcgcatggcccgtcgatccggccatcgcgatt
ccgagctacttcgtgccgcagggcgtatcggccgacacgatcgcgacgaagtggggctac
agccgcgccgacgtcgacgcatacgccgccgagagccaccgccgcgcatacgcggcgacg
caggccggctggttcgcgcgctcgatcgtgccggtgcgcgacgtcaacggcctgacgatc
ctcgatcgcgacgagacgatccgcccgcagacgacgcccgagacgctcgcgacgctcaag
ccttcgttcgccgagctgggcgagatgtacggcttcgacgcggtgatccgccagcgctat
ccggagctcgaacgcatcgagcacgtgcatcacgcgggcaacagctcggggatcgtcgac
ggcgcgtcggccgtgctgatcggctcgctcgaggcgggcaagcgcgcgggcctcgcgccg
cgcgcgcgggtccgctcgttcgcgagcatcggctcggagccgtcgatcatgctgacgggg
ccggcctacgcggccgagaaggcgctcaagcgcgccggcatgcgcgcggccgacatcgac
ctgtacgagctgaacgaagcgttcgcgtcggtcgtgctgcgcttcatggacgcgatggcg
attgcgcacgaccggatcaacgtgaacggcggcgcgatcgcgatgggccatccgctcggc
gcgacgggcgcgatgatcctcggcacgctgctcgacgagctggagcggcgcggcgcggcc
acgggcctcgccaccttgtgcgtcggcgccggcatgggcacggcgaccatcatcgaacgg
atttga

DBGET integrated database retrieval system