KEGG   Burkholderia thailandensis MSMB121: BTI_684Help
Entry
BTI_684           CDS       T02644                                 

Definition
glu/Leu/Phe/Val dehydrogenase, dimerization domain protein
Orthology
K00261  
glutamate dehydrogenase (NAD(P)+) [EC:1.4.1.3]
Organism
btd  Burkholderia thailandensis MSMB121
Pathway
Alanine, aspartate and glutamate metabolism
Arginine and proline metabolism
D-Glutamine and D-glutamate metabolism
Nitrogen metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:btd00001]
 Metabolism
  Energy metabolism
   00910 Nitrogen metabolism
    BTI_684
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    BTI_684
   00330 Arginine and proline metabolism
    BTI_684
  Metabolism of other amino acids
   00471 D-Glutamine and D-glutamate metabolism
    BTI_684
Enzymes [BR:btd01000]
 1. Oxidoreductases
  1.4  Acting on the CH-NH2 group of donors
   1.4.1  With NAD+ or NADP+ as acceptor
    1.4.1.3  glutamate dehydrogenase [NAD(P)+]
     BTI_684
Exosome [BR:btd04147]
 Exosomal proteins
  Exosomal proteins of breast cancer cells
   BTI_684
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1:739791..741095
Genome map
AA seq 434 aa AA seqDB search
MSSQSQSPSVAQSIPSYLHADDLGPWGNYLQQVDRVAPYLGSLSRWIETLKRPKRILIVD
VPIELDNGTVAHFEGYRVQHNVSRGPGKGGVRYHQDVTLSEVMALSAWMSVKNAAVNVPY
GGAKGGIRVDPRKLSRGELERVTRRYTSEIGIIIGPNTDIPAPDVNTNEQIMAWMMDTYS
MNQGQTATGVVTGKPISLGGSLGRREATGRGVFVVGCEAAKKKGVEIEGARIAVQGFGNV
GGIAAKLFQEAGAKVIAVQDHTGTIYQPAGVDTVKLIDHVGVTGGVAGFEGAEPMPNDEF
WTVETDILIPAALENQITEKNASKIRTKIIVEGANGPTTTAADDILSANGVLVIPDVIAN
AGGVTVSYFEWVQDFSSFFWTEDEINHRLERVMREAFAGVWAVAQEHGVSVRTAAFIVAC
KRILMAREMRGLYP
NT seq 1305 nt NT seq  +upstreamnt  +downstreamnt
atgtcttcgcaatcgcagtccccgtccgtcgcgcagtccatcccgtcgtacctgcacgcg
gacgatctcggcccctggggcaactatctgcagcaagtcgatcgcgtcgcgccgtacctc
ggctcgctgtcgcgctggatcgagacgctgaagcgcccgaagcgcatcctgatcgtcgac
gtgccgatcgagctggacaacggcaccgtcgcgcacttcgagggctatcgcgtgcagcac
aacgtatcgcgcggcccgggcaagggcggcgtgcgctaccaccaggacgtgacgttgtcc
gaggtgatggcgctgtccgcctggatgtcggtgaagaacgcggccgtgaacgtgccgtac
ggcggcgcgaagggcggcatccgcgtcgatccgcgcaagctctcgcgcggcgagctcgag
cgcgtgacgcgccgctacaccagcgaaatcggcatcatcatcggcccgaacaccgacatc
cccgcgcctgacgtcaacacgaacgagcagatcatggcgtggatgatggacacgtactcg
atgaaccagggccagacggccacgggcgtcgtgaccggcaagccgatctcgctcggcggc
tcgctcggccgccgggaagcgacgggccgcggcgtgttcgtcgtcggctgcgaggccgcg
aagaagaagggtgtcgagatcgaaggcgcgcgcatcgcggtccagggcttcggcaacgtc
ggcgggatcgccgcgaagctgttccaggaggcgggcgcgaaggtgatcgcggtgcaggat
cacacgggcacgatctaccagccggcgggcgtcgacaccgtcaagctgatcgaccacgtc
ggcgtgacgggcggcgtcgcgggcttcgaaggcgcggagccgatgccgaacgacgagttc
tggaccgtcgagaccgacatcctgattccggccgcgctggaaaaccagatcaccgagaag
aacgcgtcgaagatccgcacgaagatcatcgtcgaaggcgcgaacggcccgacgacgacg
gccgcggacgacatcctgagcgcgaacggcgtgctcgtgattcccgacgtgatcgcgaac
gcgggaggcgtgaccgtgtcgtacttcgagtgggtgcaggatttctcgagcttcttctgg
acggaagacgagatcaaccatcgtctcgagcgcgtgatgcgcgaggcgttcgccggtgtg
tgggcggtggcccaggagcacggcgtgtcggtgcgcacggcggcgttcatcgtcgcgtgc
aagcgcatcctgatggcgcgcgaaatgcgcggcctgtacccctga

DBGET integrated database retrieval system