KEGG   Burkholderia thailandensis E264: BTH_I0042Help
Entry
BTH_I0042         CDS       T00311                                 

Definition
type III restriction-modification system, res subunit
Orthology
K01156  
type III restriction enzyme [EC:3.1.21.5]
Organism
bte  Burkholderia thailandensis E264
Brite
Enzymes [BR:bte01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.21  Endodeoxyribonucleases producing 5'-phosphomonoesters
    3.1.21.5  type III site-specific deoxyribonuclease
     BTH_I0042
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
I:43366..46395
Genome map
AA seq 1009 aa AA seqDB search
MQLHFESDLDYQLEAIEAVCGLFRGQEACRAEFSVTAQAARRRASPQISLGMAESGLGVG
NRLTLDAHTFAENLARVQVRNGLPPSGAPRSNDFTVEMETGTGKTYVYLRTIFELHRRFD
FTKFVIVVPSVAIKEGVYKTLQITERHFRRLYAGVPFDYFVYDSAKLGEVRSFASKSTVQ
IMIVTVAAINKKDVNTLYKDSEQTGGEKPIDLIRAAHPIVIVDEPQSVDGGLDGRGKEAL
DAMHPLCTLRYSATHADKYQMLYRLDAIDAYERKLVKQVEIASATVEDAHNKPFMRVMSI
GSRRGAIAARVELDVATAAGDVERQTVSVSDGDDLERIARRAVYANFRIGEIHAARGAEY
LVLRYPGGDAFLSIGDTYGDVDTLAIQREMIRRTIREHLDKELRLTPLGVKVLSLFFVDA
VDKYRKYDRHGQPFKGDYARLFEEEYRRAAKLPEYRALFAGVDCAIAAEAVHDGYFSIDR
KGGWTDTSDKSAGSRENAERAYGLIMKDKERLLSFDTPLKFIFSHSALKEGWDNPNVFQI
CTLRDIRSERERRQTIGRGLRLAVNQRGERVRGFDVNTLTVIAGESYEQFAENLQKEIEA
DTGIRFGIVETHQFAALPVPAGDGSVQPLGVERSTALWTYLRDAGYLDARGRVQDTLRAA
LKLRALPVPDEFGSQRALIVDMLRKLAGRLDVRNADERRHIALRPDAHGKAVYLGDEFRA
LWERIQYRTTYRVNFDNARLIERCVAALKAAPAVARARLQWRKAEIAIDAAGVEAIETEA
AGAIAIDEGEIDLPDLLTELQDRTQLTRRTIATVLIESGRLDEFPRNPQRFIALVAAALE
RCKRDALVDGIEYKLLGKEHVHALSLFEDEPLTGYLSSMRRGAAKSIHEDVPCETPAERV
FVESLERDDAVRLYAKLPGWFKIPTPLGSYSPDWAVLIAEGDGPRLYFVVESKSGIADSD
LHAHERRRIQCGAAHFRALEAASVNPARYVRARCADDLPTAPANARDAA
NT seq 3030 nt NT seq  +upstreamnt  +downstreamnt
atgcagttgcatttcgagtcggatctcgactatcagctcgaagcgatcgaggcggtatgc
ggtctgtttcgcggccaggaggcgtgccgcgccgaattcagcgtgaccgcgcaggccgcg
cggcggcgcgcgagcccgcagatttcgctcgggatggccgaatcggggctcggcgtcggc
aatcgcctgacgctcgacgcgcacacgttcgccgagaatctcgcgcgcgtgcaggtgcgc
aacgggctgccgccgtccggcgcgccgcgctcgaacgatttcaccgtcgagatggaaacg
ggcacgggcaagacttacgtatacctgcgcacgatcttcgagctgcaccgccgcttcgac
ttcacgaagttcgtgatcgtcgtgccgtcggtcgcgatcaaggaaggcgtgtacaagacg
ctgcagatcaccgagcggcatttccggcgcctgtacgcgggcgtgccgttcgactatttc
gtctacgattcggcgaagctcggcgaggtgcgcagcttcgcgtcgaaatcgaccgtgcag
atcatgatcgtcacggtcgcggcgatcaacaagaaggacgtcaacacgctctacaaggac
agcgaacagacgggcggcgaaaagccgatcgacctgattcgcgcggcgcatccgatcgtg
atcgtcgacgagccgcagagcgtggacggcgggctcgacgggcgcggcaaggaagcgctc
gacgcgatgcacccgctctgcacgctgcgctattcggcgacgcacgcggacaagtatcag
atgctgtaccggctcgacgcgatcgacgcgtacgagcgcaagctcgtcaagcaggtcgag
atcgcgtcggcgacggtcgaggatgcgcacaacaagccgttcatgcgcgtgatgtcgatc
ggcagccggcgcggggcgatcgccgcgcgcgtcgagctcgacgtcgcgacggccgcgggc
gacgtcgagcggcagacggtttccgtctccgacggcgacgatctcgagcgcatcgcgcgc
cgcgccgtctacgcgaacttcaggatcggcgagattcacgcggcgcgcggcgccgagtat
ctggtgctgcgctatccgggcggcgatgcgttcctgtcgatcggcgacacatatggcgac
gtcgatacgctcgcgatccagcgcgagatgatccgccgcacgatccgcgagcatctcgac
aaggaactgcggctcacgccgctcggcgtgaaggtgctgtcgctcttcttcgtcgatgcg
gtcgacaagtatcgcaagtacgaccgccacggccagccgttcaagggcgattacgcgcgg
ctgttcgaagaagaataccggcgcgcggcgaagctgccggaatatcgcgcgctgtttgcc
ggcgtcgattgcgcgatcgcggccgaggccgtgcacgacggctatttctcgatcgacagg
aaaggcggctggaccgacacgagcgacaagagcgcgggcagccgagagaacgcggagcgc
gcgtacggcctcatcatgaaggacaaggagcggctgttgtcgttcgacacgccgctcaag
ttcatcttctcgcattcggcgctgaaggaaggctgggacaatccgaacgtgttccagatc
tgcacgctgcgcgacatccgcagcgagcgcgagcggcgccagacgatcggccgcgggctg
cgtctcgccgtcaaccagcgcggcgagcgcgtgcgcggcttcgacgtcaacacgctgacg
gtgatcgcgggcgagagctacgagcagttcgccgagaacctgcagaaggaaatcgaagcc
gatacgggcatccgcttcggcatcgtcgaaacgcatcagttcgccgcgctgcccgtgccg
gcgggcgacggcagcgtgcagccgctcggcgtcgaacggtccaccgcgctatggacgtat
ctgcgcgacgccggctatctcgatgcgcgcggccgcgtgcaggacacgctgcgcgcggcg
ctcaagctgcgcgcgctgccggtgcccgatgaattcggctcgcagcgcgcgctgatcgtc
gacatgctgcgcaagctcgcggggcggctcgacgtgcgcaacgcggacgagcgccgccac
atcgcgctgcggcccgacgcgcatggcaaggcggtgtacctgggcgacgaattccgcgcg
ctgtgggagcgcatccagtaccggacgacctaccgcgtgaacttcgacaacgcacgcctg
atcgagcgctgcgtcgccgcgctgaaggccgcgcccgccgtcgcgcgcgcgcggctgcag
tggcgcaaggccgaaatcgcgatcgacgcggcgggcgtcgaggcgatcgaaaccgaggcg
gcgggcgcgatcgcgatcgacgaaggcgaaatcgacctgccggatctgctgaccgagctg
caggaccgcacgcagctcacgcggcgcacgatcgcgaccgtgctgatcgaaagcggcagg
ctcgacgagttcccgcgcaatccgcagcgcttcatcgcgctcgtcgctgcggcgctcgag
cgctgcaagcgcgacgcgctcgtcgacgggatcgaatacaagttgctcggcaaggagcac
gtgcatgcgctgtcgctgttcgaggacgagccgcttaccggctatctgtcgagcatgcgg
cgcggcgcggcgaaatcgatccatgaggacgtgccgtgcgaaacgcctgccgagcgcgtg
ttcgtcgaatcgctcgaacgggacgacgcggtcaggctgtacgcgaagctgcccggctgg
ttcaagatcccgacgccgctcggcagctacagccccgactgggcggtgctgatcgccgag
ggcgacgggccgcgcctctatttcgtcgtcgaatcgaagagcggcatcgccgacagcgat
ctgcacgctcacgagcggcgcaggattcagtgcggcgcggcgcatttccgcgcgctcgag
gcggcctcggtcaatcctgcgcgctatgtgcgcgcgcgttgcgccgacgatctgccgacg
gcccccgccaacgcgcgcgacgcggcctga

DBGET integrated database retrieval system