KEGG   Burkholderia thailandensis E264: BTH_I0062Help
Entry
BTH_I0062         CDS       T00311                                 

Definition
(GenBank) fatty oxidation complex, alpha subunit
  KO
K01782  3-hydroxyacyl-CoA dehydrogenase / enoyl-CoA hydratase / 3-hydroxybutyryl-CoA epimerase [EC:1.1.1.35 4.2.1.17 5.1.2.3]
Organism
bte  Burkholderia thailandensis E264
Pathway
bte00071  Fatty acid degradation
bte00280  Valine, leucine and isoleucine degradation
bte00281  Geraniol degradation
bte00310  Lysine degradation
bte00362  Benzoate degradation
bte00380  Tryptophan metabolism
bte00410  beta-Alanine metabolism
bte00640  Propanoate metabolism
bte00650  Butanoate metabolism
bte00903  Limonene and pinene degradation
bte00930  Caprolactam degradation
bte01040  Biosynthesis of unsaturated fatty acids
bte01100  Metabolic pathways
bte01110  Biosynthesis of secondary metabolites
bte01120  Microbial metabolism in diverse environments
bte01130  Biosynthesis of antibiotics
bte01200  Carbon metabolism
bte01212  Fatty acid metabolism
Module
bte_M00087  beta-Oxidation
Brite
KEGG Orthology (KO) [BR:bte00001]
 Metabolism
  Carbohydrate metabolism
   00640 Propanoate metabolism
    BTH_I0062
   00650 Butanoate metabolism
    BTH_I0062
  Lipid metabolism
   00071 Fatty acid degradation
    BTH_I0062
   01040 Biosynthesis of unsaturated fatty acids
    BTH_I0062
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    BTH_I0062
   00310 Lysine degradation
    BTH_I0062
   00380 Tryptophan metabolism
    BTH_I0062
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    BTH_I0062
  Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    BTH_I0062
   00281 Geraniol degradation
    BTH_I0062
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    BTH_I0062
   00930 Caprolactam degradation
    BTH_I0062
Enzymes [BR:bte01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.35  3-hydroxyacyl-CoA dehydrogenase
     BTH_I0062
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     BTH_I0062
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.2  Acting on hydroxy acids and derivatives
    5.1.2.3  3-hydroxybutyryl-CoA epimerase
     BTH_I0062
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 3HCDH_N ECH_1 3HCDH ECH_2 NAD_binding_8 NAD_binding_2 DAO F420_oxidored UDPG_MGDP_dh_N AlaDh_PNT_C DUF2680 ApbA Pyr_redox_2 NAD_Gly3P_dh_N Sacchrp_dh_NADP 2-Hacid_dh_C
Motif
Other DBs
NCBI-ProteinID: ABC37159
UniProt: Q2T2J1
Position
I:68384..70507
Genome map
AA seq 707 aa AA seqDB search
MIDYTLDDDGIAALSWNLPGRSQNVLNGESCAAFFAAASRALQDAAVKGILVTSAKPDFI
AGGDLEWLQASDDAETLFARTCELHRALRALETGGKPVAIAMPGSALGGGLEIALAGHYR
VAADNPKARFGLPEVTLGLLPGGGGTQRLPRLVGIQASLPLLLEGKRLKAADALAAGILH
AVVPAGEEIAAARAWLLDASRRTATQPWDVKGFRIPGGALTHPSVQQVFMAANALARQKT
YGNYPAVASILSCVYEGLLTDLDTGLKTEARYFVKAVLSPQAKAMIRTLFFGMNEANKLA
ARPAGVPTQRYRKIGVLGAGMMGAGIAYVSAKAGLDVVLIDTSEEAAARGKDYSRKLVDK
QVQRGRLTREKADALLAKIVPTTDYARLDGAELVIEAVFEDRAIKADVTRRSETVLAPDA
LFASNTSTLPITGLAQASARPANFIGLHFFSPVDKMPLVEVIVGRDTSEATLARALDYVK
TIGMTPIVVNDSRGFYTSRVFSTYVLEGLAMLAEGVAPALIENAGLLAGMPVGPLALTDE
VSSELIHKITKQTRADLGDAYVARPGEDVAARMVELGRLGRKAGLGYYDYPANGGKKALW
PGLAQAFPVAAEQPDVAALIERLVTVQAVETARCLEERVLTTARDADVGAILGWGFPAFR
GGPVSYIHGVGVDAFVATCDRLAARYGARFAAPGLLREMAAQGRSFY
NT seq 2124 nt NT seq  +upstreamnt  +downstreamnt
atgatcgattacacgctcgatgacgacggcatcgcggccttgagctggaatctgcccggg
cgcagccagaacgtgctgaacggcgagagctgcgcggcgttcttcgcggcggcgtcgcgc
gcgcttcaggatgcggcggtgaaggggatactcgtcacgtcggcgaagcccgacttcatc
gcgggcggcgacctcgaatggctgcaggcgagcgacgacgccgagacgctcttcgcgcgc
acgtgcgagctgcaccgtgcgctgcgcgcgctcgaaacaggcggcaagccggtggcgatc
gcgatgccgggctcggcgctcggcggcgggctcgagatcgcgctcgcgggtcactaccgg
gttgcggccgacaatccgaaggcgcgcttcggcctgcccgaagtgacgctcggcctgctg
ccgggcggcggcggcacgcagcgcctgccgcgcctcgtcggcattcaggcgtcgctgccg
ctgttgctcgaaggcaagcggctgaaggcggccgacgcgctggccgccggcatcctgcac
gcggtcgtgccggcgggcgaggagatcgcggccgcgcgcgcgtggctgctcgacgcgagc
cgccgcaccgcgacgcagccgtgggacgtgaagggcttccggattccgggcggcgcgctc
acgcatccgtccgtccagcaggtgttcatggcggcgaacgcgctcgcgcgacagaagacg
tacggcaactatccggccgtcgcgagcatcctgtcgtgcgtgtacgaagggctgctgacc
gatctcgacacgggcctgaagaccgaggcgcgctatttcgtgaaggcggtgctgtcgccg
caagcgaaggcgatgatccgcacgctgttcttcgggatgaacgaagcgaacaagctcgcc
gcgcggccggccggcgtgccgacgcagcgctaccggaagatcggcgtgctcggcgcgggg
atgatgggcgcgggcatcgcgtacgtgagcgcgaaggcggggctcgacgtcgtgctgatc
gacacgagcgaagaggcggccgcgcgcggcaaggactactcgcgcaagctcgtcgacaaa
caggtgcagcgcggccggctcacgcgggaaaaggccgatgcattgcttgcgaagatcgtg
ccgacgaccgattacgcgcggctcgacggcgcggagctcgtgatcgaggcggtgttcgag
gatcgcgcgatcaaggccgacgtcacgcgcaggagcgaaacggtgctcgcgcccgacgcg
ctcttcgcgtcgaacacgtcgacgctgccgatcacgggcctcgcgcaggcgagcgcgcgg
ccggcgaacttcatcggcctgcatttcttctcgcccgtcgacaagatgccgctcgtcgaa
gtgatcgtcggccgcgacacgagcgaggcgacgctcgcgcgcgcgctcgactacgtgaag
acgatcggcatgacgccgatcgtcgtcaacgattcgcgcggcttctacacgagccgcgtg
ttctcgacttacgtgctcgaagggctcgcgatgcttgccgagggcgtcgcgcccgcgctg
atcgagaacgccgggctgctcgccgggatgccggtgggcccgctcgcgctgaccgacgag
gtgtcgagcgagttgatccacaagatcacgaagcagacgcgcgccgatctcggcgacgcg
tacgtcgcgcgccccggcgaggacgtggccgcgcgcatggtcgagctcggccggctcggc
cgcaaggcggggctcggctattacgactatccggcgaacggcggcaagaaggcgctgtgg
ccggggctcgcgcaagcgtttcccgtcgcggccgagcagccggacgtggcggcgctgatc
gagcggctcgtgacggtgcaggcggtcgagaccgcgcgctgcctcgaagagcgcgtgctg
acgacggcgcgcgacgcggacgtcggcgcgattctcggctggggcttcccggcgttccgc
ggcgggccggtgtcgtacattcacggcgtcggggtggacgcgttcgtcgcgacgtgcgat
cgtcttgccgcgcggtacggcgcgcgcttcgccgcgccggggctgctgcgcgagatggcc
gcgcaggggcgaagcttctactga

DBGET integrated database retrieval system