KEGG   Burkholderia thailandensis E264: BTH_I0416Help
Entry
BTH_I0416         CDS       T00311                                 

Definition
(GenBank) phosphoglycerate mutase
  KO
K01834  
2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
bte  Burkholderia thailandensis E264
Pathway
Glycolysis / Gluconeogenesis
Glycine, serine and threonine metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:bte00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    BTH_I0416
   01230 Biosynthesis of amino acids
    BTH_I0416
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    BTH_I0416
  Energy metabolism
   00680 Methane metabolism
    BTH_I0416
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    BTH_I0416
Enzymes [BR:bte01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.11  phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
     BTH_I0416
Exosome [BR:bte04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   BTH_I0416
  Exosomal proteins of melanoma cells
   BTH_I0416
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
Position
I:complement(463539..464291)
Genome map
AA seq 250 aa AA seqDB search
MYKLVLIRHGESTWNKENRFTGWVDVDLTEQGNSEARQAGLLLKEAGYTFDIAYTSVLKR
AIRTLWHVQDQMDLMYVPVVHSWRLNERHYGALSGLNKAETAAKYGDEQVLVWRRSYDTP
PPALEPTDERAPYGDPRYAKVPREQLPLTECLKDTVARVLPLWNESIAPAVKAGKQVLIA
AHGNSIRALVKYLDGISDADIVGLNIPNGVPLVYELDANLTPIRHYYLGDPEAIAKAQAA
VAQQGKASAA
NT seq 753 nt NT seq  +upstreamnt  +downstreamnt
atgtacaagctcgttctcatccgccacggcgaatcgacctggaacaaggaaaaccgcttc
accggctgggtcgacgtcgacctgaccgaacaaggcaacagcgaagcccggcaggccggg
ctgctcctgaaggaagccggctacacgttcgatatcgcatacacgtcggtgctcaagcgc
gcgatccgcacgctctggcacgttcaggaccagatggatctgatgtacgtgcccgtcgtc
cattcgtggcggctgaacgagcgtcattacggcgcgctgtcgggcctgaacaaggctgag
acggccgcgaagtacggcgacgagcaggtgctcgtctggcgccgcagctacgacacgccg
ccgcccgcgctcgagccgaccgacgagcgcgcgccatacggcgatccgcgctacgcgaag
gtgccgcgcgagcaactcccgctcaccgagtgcctgaaggacacggtcgcgcgcgtgctg
ccgctgtggaacgaatcgatcgcgcccgcggtgaaggccggcaagcaggtgctgatcgcc
gcgcacggcaactcgatccgcgcgctggtcaagtatctcgacggcatttcggacgcggac
atcgtcggcctgaacattccgaacggcgtgccgctcgtctacgagctcgacgcgaacctc
acgcccatccggcactactacctcggcgacccggaagcgatcgcgaaggcgcaggccgcc
gtcgcgcagcagggcaaggcgtccgcggcgtaa

DBGET integrated database retrieval system